Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8426.t1
Gene name
Locationscaffold_32:193518..194533
Strand-
Gene length (bp)1015
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 2.7E-17 7 255
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 1.7E-05 86 276

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 24.36 11.14 37.57
5d_25C Five days - 25 degrees Celsius 24.93 11.29 38.58
7d_25C Seven days - 25 degrees Celsius 25.40 11.73 39.07
10d_25C Ten days - 25 degrees Celsius 22.92 10.16 35.68
7d_15C Seven days - 15 degrees Celsius 41.60 21.30 61.89
7d_30C Seven days - 30 degrees Celsius 19.89 8.55 31.23

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.963207 no
3d_25C 7d_25C 0.928840 no
3d_25C 7d_15C 0.053498 no
3d_25C 7d_30C 0.588259 no
3d_25C 10d_25C 0.895500 no
5d_25C 7d_25C 0.970296 no
5d_25C 7d_15C 0.066479 no
5d_25C 7d_30C 0.537936 no
5d_25C 10d_25C 0.852139 no
7d_25C 7d_15C 0.078462 no
7d_25C 7d_30C 0.497875 no
7d_25C 10d_25C 0.813986 no
7d_15C 7d_30C 0.007779 yes
7d_15C 10d_25C 0.040411 yes
7d_30C 10d_25C 0.731016 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8426.t1
MDESGLRILRVWGFNDVNTIPSSGTVYYQLLKDGTATINTGADGLQRLDYVVTSAEARNVKLVINFVNNWSDYGG
MAAYATAFGSSQTTWYTNTAAQTAYRAYIKAVVARYINSPAVFAWELANEPRCNGCNTSVLYNWIQSTSAYIKSL
DSKHMVAIGDEGFGLDTGSDGSYPYSYGEGLNFTMNLGIDTIDFATFHLYPTSWGTTNDWGNGWITSHGAACAAA
GKPCLFEEYGATSNHCSIEAPWQKTALNTTGIAADLYWQYGDTLSSGKSADDGNTFYYGTSDFTCLVTDHVAAID
S*
Coding >Pro_DTO377G3_2|g8426.t1
ATGGATGAATCTGGGCTCCGAATCCTCCGAGTTTGGGGATTCAACGATGTCAACACTATTCCATCTTCGGGGACT
GTTTATTATCAACTACTCAAAGATGGAACTGCCACTATCAACACCGGTGCAGATGGCCTACAGCGCCTGGATTAT
GTGGTTACCTCCGCCGAGGCACGGAATGTGAAACTCGTCATCAATTTTGTCAACAACTGGTCGGATTATGGAGGT
ATGGCGGCCTATGCCACTGCTTTCGGTAGCAGCCAGACAACCTGGTATACAAATACTGCAGCTCAAACAGCCTAC
CGGGCTTACATCAAAGCTGTTGTTGCCCGGTATATCAATTCGCCTGCCGTCTTTGCATGGGAGTTGGCCAATGAG
CCCCGCTGCAATGGCTGTAACACTTCGGTTCTTTACAACTGGATCCAGTCTACCAGTGCCTATATCAAGTCTCTA
GACTCGAAGCATATGGTTGCCATTGGCGATGAAGGCTTCGGACTGGACACTGGGTCTGATGGCAGCTATCCCTAC
AGCTACGGCGAGGGTTTGAACTTTACGATGAATCTAGGGATTGATACCATCGACTTTGCTACATTCCATCTCTAC
CCCACAAGCTGGGGAACCACTAACGATTGGGGCAATGGATGGATCACATCCCACGGAGCCGCCTGTGCAGCAGCT
GGCAAGCCATGTCTCTTTGAAGAGTACGGTGCTACTTCCAATCACTGTAGCATTGAGGCACCATGGCAGAAGACA
GCGTTGAACACCACTGGAATTGCAGCTGATCTCTACTGGCAGTATGGAGACACGCTGAGCTCGGGAAAATCGGCC
GATGATGGAAACACCTTCTACTATGGCACTAGTGACTTTACCTGTCTGGTGACGGACCACGTCGCAGCCATTGAC
TCCTAG
Transcript >Pro_DTO377G3_2|g8426.t1
ATGGATGAATCTGGGCTCCGAATCCTCCGAGTTTGGGGATTCAACGATGTCAACACTATTCCATCTTCGGGGACT
GTTTATTATCAACTACTCAAAGATGGAACTGCCACTATCAACACCGGTGCAGATGGCCTACAGCGCCTGGATTAT
GTGGTTACCTCCGCCGAGGCACGGAATGTGAAACTCGTCATCAATTTTGTCAACAACTGGTCGGATTATGGAGGT
ATGGCGGCCTATGCCACTGCTTTCGGTAGCAGCCAGACAACCTGGTATACAAATACTGCAGCTCAAACAGCCTAC
CGGGCTTACATCAAAGCTGTTGTTGCCCGGTATATCAATTCGCCTGCCGTCTTTGCATGGGAGTTGGCCAATGAG
CCCCGCTGCAATGGCTGTAACACTTCGGTTCTTTACAACTGGATCCAGTCTACCAGTGCCTATATCAAGTCTCTA
GACTCGAAGCATATGGTTGCCATTGGCGATGAAGGCTTCGGACTGGACACTGGGTCTGATGGCAGCTATCCCTAC
AGCTACGGCGAGGGTTTGAACTTTACGATGAATCTAGGGATTGATACCATCGACTTTGCTACATTCCATCTCTAC
CCCACAAGCTGGGGAACCACTAACGATTGGGGCAATGGATGGATCACATCCCACGGAGCCGCCTGTGCAGCAGCT
GGCAAGCCATGTCTCTTTGAAGAGTACGGTGCTACTTCCAATCACTGTAGCATTGAGGCACCATGGCAGAAGACA
GCGTTGAACACCACTGGAATTGCAGCTGATCTCTACTGGCAGTATGGAGACACGCTGAGCTCGGGAAAATCGGCC
GATGATGGAAACACCTTCTACTATGGCACTAGTGACTTTACCTGTCTGGTGACGGACCACGTCGCAGCCATTGAC
TCCTAG
Gene >Pro_DTO377G3_2|g8426.t1
ATGGATGAATCTGGGCTCCGAATCCTCCGAGTTTGGGGATTCAACGATGTCAACACTATTCCATCTTCGGGGACT
GTTTATTATCAACTACTCAAAGATGGAACTGCCACTATCAACACCGGTGCAGATGGCCTACAGCGCCTGGATTAT
GTGGTTACCTCCGCCGAGGCACGGAATGTGAAACTCGTCATCAATTTTGTCAACAACTGGTCGGATTATGGAGGT
ATGGCGGCCTATGCCACTGCTTTCGGTAGCAGCCAGACAACCTGGTATACAAATACTGCAGCTCAAACAGCCTAC
CGGGCTTACATCAAAGCTGTTGTTGCCCGGTATATCAATTCGCCTGCCGTCTTTGCATGGGAGTTGGCCAATGAG
CCCCGCTGCAATGGCTGTAACACTTCGGTTCTTTACAACTGGATCCAGTCTACCAGTGCCTATATCAAGTCTCTA
GACTCGAAGCATATGGTTGCCATTGGCGATGGTATCTAGGCCCGTAATATCTCTCCCATCATCCATTGTCTAACT
CATATTATAGAAGGCTTCGGACTGGACACTGGGTCTGATGGCAGCTATCCCTACAGCTACGGCGAGGGTTTGAAC
TTTACGATGAATCTAGGGATTGATACCATCGACTTTGCTACATTCCATCTCTACCCCACAAGCTGTATGTATATC
CTTTTCCCATGACCCTTGGTCCAGAGCTAATGTATTCGCACAAGGGGGAACCACTAACGATTGGGGCAATGGATG
GATCACATCCCACGGAGCCGCCTGTGCAGCAGCTGGCAAGCCATGTCTCTTTGAAGAGTACGGTGCTACTTCCAA
TCACTGTAGCATTGAGGCACCATGGCAGAAGACAGCGTTGAACACCACTGGAATTGCAGCTGATCTCTACTGGCA
GTATGGAGACACGCTGAGCTCGGGAAAATCGGCCGATGATGGAAACACCTTCTACTATGGCACTAGTGACTTTAC
CTGTCTGGTGACGGACCACGTCGCAGCCATTGACTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail