Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8413.t1
Gene name
Locationscaffold_32:163864..166189
Strand+
Gene length (bp)2325
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16508 NIBRIN_BRCT_II Second BRCT domain on Nijmegen syndrome breakage protein 6.6E-41 241 362
PF00498 FHA FHA domain 4.4E-08 25 98

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 21.46 12.15 30.77
5d_25C Five days - 25 degrees Celsius 23.06 13.17 32.94
7d_25C Seven days - 25 degrees Celsius 25.96 15.12 36.81
10d_25C Ten days - 25 degrees Celsius 22.55 12.82 32.29
7d_15C Seven days - 15 degrees Celsius 13.11 6.66 19.55
7d_30C Seven days - 30 degrees Celsius 23.95 13.78 34.13

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.834354 no
3d_25C 7d_25C 0.500725 no
3d_25C 7d_15C 0.047696 yes
3d_25C 7d_30C 0.731016 no
3d_25C 10d_25C 0.891664 no
5d_25C 7d_25C 0.694325 no
5d_25C 7d_15C 0.022165 yes
5d_25C 7d_30C 0.915152 no
5d_25C 10d_25C 0.952490 no
7d_25C 7d_15C 0.004450 yes
7d_25C 7d_30C 0.805960 no
7d_25C 10d_25C 0.636919 no
7d_15C 7d_30C 0.009446 yes
7d_15C 10d_25C 0.024170 yes
7d_30C 10d_25C 0.864756 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8413.t1
MWILDSTGDFLEGKRVWLRPGKRYLFGRFHRDGVRHAVNHNSISRKHMTIEISPVSPRDGLSLRARSNITITDLD
SKKGTVVDERRIQGECKLEKSDEHLIQLAKYQHALRIKWEPVVLTLSSSSKQVRGEDPLAHVRSRLEDLDIKTIM
DYIVDHTTHVVQRKRNTAKGLQALVNGKYIVDDSYIDALVYAATPGDLENIESLCPLETDFELAWPDPNQHLPPP
GKEPTQRPAAAFAPNPARINVFEGYTFIFGDPSQFENLQGPINNGQGKALLYEIEDGVTTAADIVRFIKKAAGQK
GVGPERHGSGGVVLVRFRSKGDLEQWSIDVGNEVALMMDQRVIEQREFLDAILGNDASPLCRTLPTEESSSQITA
STPAVEAEQTSQQAVSAVPESVDLPNSEPSQPSKAPAKTRVRAYVSKMKTFDDGFDMESVPVYAPEEEDTNINST
QTIDIETQAPSQEIQPLNIVKEEAEEDMVADLLPGARAMKRRRADMTRHHPEDEAVAPESEAPKRKRPKLDVLEA
ARKHREEEEQQRKAEEDSHSADVGDVDVDKLKNLAIVEEMEIPVRNAPAHEHDSSDRWDDQWNGRKNFKKFRRKG
EPRSRARIQTVIVPLEEVTRKDYGIGDHYWGGNPAETYPQNEAGGPESDHHDEVAPSRSKLSAITRTSLQPTSDP
TPARPPKRAREERDSDSDDELRFRFRRKR*
Coding >Pro_DTO377G3_2|g8413.t1
ATGTGGATTCTTGATTCGACCGGTGATTTTCTGGAAGGGAAGCGCGTGTGGCTGCGCCCTGGAAAGAGGTATCTA
TTCGGTCGATTCCATCGAGACGGAGTCCGCCATGCTGTCAATCATAATTCGATATCCCGCAAGCATATGACCATT
GAAATCTCACCGGTCAGTCCGCGAGATGGGTTGTCACTACGAGCGCGATCCAATATCACCATAACCGATTTAGAC
TCGAAGAAAGGAACAGTCGTTGACGAGAGGAGAATCCAAGGAGAATGCAAGTTGGAGAAGAGCGATGAGCATCTC
ATCCAGCTCGCTAAATACCAGCATGCGCTCCGGATCAAATGGGAGCCCGTGGTTCTGACCTTGTCATCCTCCTCC
AAGCAGGTGCGAGGTGAAGATCCTCTAGCCCATGTTCGCTCACGTCTAGAAGACCTCGACATTAAGACCATCATG
GATTATATTGTCGATCACACAACACATGTGGTACAGCGCAAACGGAATACAGCTAAGGGTCTTCAGGCACTCGTC
AACGGGAAGTACATAGTAGATGATTCATATATCGATGCACTCGTCTACGCGGCTACCCCCGGGGATCTTGAGAAC
ATTGAGTCGCTATGTCCACTTGAAACCGACTTCGAATTAGCATGGCCCGATCCAAATCAACACCTTCCGCCCCCC
GGGAAAGAACCAACCCAGCGTCCCGCCGCTGCTTTCGCTCCCAATCCCGCACGTATTAATGTCTTTGAGGGATAT
ACGTTTATTTTCGGTGATCCAAGCCAGTTTGAAAACCTACAAGGTCCAATCAACAATGGCCAAGGGAAGGCGCTC
CTCTACGAAATTGAAGATGGGGTCACAACTGCCGCAGATATTGTTCGGTTTATAAAAAAGGCAGCAGGACAGAAA
GGCGTGGGCCCCGAGCGACACGGTTCCGGTGGCGTCGTTCTTGTTCGCTTTCGATCGAAAGGAGACCTCGAACAA
TGGTCTATTGACGTCGGTAATGAGGTTGCTCTAATGATGGACCAGCGCGTGATAGAGCAACGAGAGTTCCTTGAC
GCTATCCTTGGAAATGATGCATCACCCCTCTGCCGTACCTTGCCCACGGAGGAGAGCTCTAGTCAGATCACCGCA
TCTACACCCGCGGTCGAGGCTGAACAAACAAGCCAACAAGCAGTTTCTGCCGTACCTGAATCGGTAGATCTGCCT
AACTCTGAGCCTAGTCAACCCTCGAAAGCTCCGGCCAAGACCCGTGTGCGTGCATACGTCAGTAAAATGAAAACC
TTCGATGACGGATTCGACATGGAATCTGTCCCAGTGTATGCACCTGAAGAAGAGGACACCAATATCAACTCCACT
CAAACCATCGATATCGAAACTCAAGCGCCATCTCAAGAAATCCAGCCCCTGAATATAGTAAAGGAAGAGGCTGAG
GAGGACATGGTGGCTGATCTTCTCCCGGGCGCCCGTGCAATGAAGCGTCGTCGTGCAGATATGACTCGCCATCAC
CCAGAGGATGAGGCCGTAGCCCCCGAATCGGAGGCCCCGAAACGCAAGCGACCTAAACTTGACGTGCTCGAAGCC
GCGCGAAAGCACCGTGAAGAAGAAGAACAACAACGCAAGGCCGAAGAAGACTCACATTCAGCCGATGTAGGTGAT
GTGGATGTGGACAAATTGAAGAACCTGGCTATTGTGGAAGAAATGGAGATTCCCGTCCGGAACGCACCAGCGCAC
GAGCATGACAGTTCGGACAGATGGGATGATCAATGGAATGGGCGCAAGAATTTCAAGAAGTTCCGGCGAAAAGGC
GAGCCGCGTAGTCGAGCTCGCATCCAGACAGTGATCGTCCCCTTAGAAGAAGTGACCCGCAAAGACTATGGAATT
GGCGATCACTATTGGGGTGGCAATCCTGCTGAGACTTACCCTCAGAACGAGGCTGGAGGTCCTGAATCTGATCAT
CACGATGAAGTTGCTCCATCACGGTCCAAGCTGTCAGCGATTACACGCACCTCGCTTCAACCGACCTCGGACCCA
ACTCCGGCTCGGCCCCCGAAGAGGGCTCGCGAGGAGCGCGATTCGGACAGCGATGATGAACTTCGTTTCCGTTTC
AGGCGTAAGCGCTAG
Transcript >Pro_DTO377G3_2|g8413.t1
ATGTGGATTCTTGATTCGACCGGTGATTTTCTGGAAGGGAAGCGCGTGTGGCTGCGCCCTGGAAAGAGGTATCTA
TTCGGTCGATTCCATCGAGACGGAGTCCGCCATGCTGTCAATCATAATTCGATATCCCGCAAGCATATGACCATT
GAAATCTCACCGGTCAGTCCGCGAGATGGGTTGTCACTACGAGCGCGATCCAATATCACCATAACCGATTTAGAC
TCGAAGAAAGGAACAGTCGTTGACGAGAGGAGAATCCAAGGAGAATGCAAGTTGGAGAAGAGCGATGAGCATCTC
ATCCAGCTCGCTAAATACCAGCATGCGCTCCGGATCAAATGGGAGCCCGTGGTTCTGACCTTGTCATCCTCCTCC
AAGCAGGTGCGAGGTGAAGATCCTCTAGCCCATGTTCGCTCACGTCTAGAAGACCTCGACATTAAGACCATCATG
GATTATATTGTCGATCACACAACACATGTGGTACAGCGCAAACGGAATACAGCTAAGGGTCTTCAGGCACTCGTC
AACGGGAAGTACATAGTAGATGATTCATATATCGATGCACTCGTCTACGCGGCTACCCCCGGGGATCTTGAGAAC
ATTGAGTCGCTATGTCCACTTGAAACCGACTTCGAATTAGCATGGCCCGATCCAAATCAACACCTTCCGCCCCCC
GGGAAAGAACCAACCCAGCGTCCCGCCGCTGCTTTCGCTCCCAATCCCGCACGTATTAATGTCTTTGAGGGATAT
ACGTTTATTTTCGGTGATCCAAGCCAGTTTGAAAACCTACAAGGTCCAATCAACAATGGCCAAGGGAAGGCGCTC
CTCTACGAAATTGAAGATGGGGTCACAACTGCCGCAGATATTGTTCGGTTTATAAAAAAGGCAGCAGGACAGAAA
GGCGTGGGCCCCGAGCGACACGGTTCCGGTGGCGTCGTTCTTGTTCGCTTTCGATCGAAAGGAGACCTCGAACAA
TGGTCTATTGACGTCGGTAATGAGGTTGCTCTAATGATGGACCAGCGCGTGATAGAGCAACGAGAGTTCCTTGAC
GCTATCCTTGGAAATGATGCATCACCCCTCTGCCGTACCTTGCCCACGGAGGAGAGCTCTAGTCAGATCACCGCA
TCTACACCCGCGGTCGAGGCTGAACAAACAAGCCAACAAGCAGTTTCTGCCGTACCTGAATCGGTAGATCTGCCT
AACTCTGAGCCTAGTCAACCCTCGAAAGCTCCGGCCAAGACCCGTGTGCGTGCATACGTCAGTAAAATGAAAACC
TTCGATGACGGATTCGACATGGAATCTGTCCCAGTGTATGCACCTGAAGAAGAGGACACCAATATCAACTCCACT
CAAACCATCGATATCGAAACTCAAGCGCCATCTCAAGAAATCCAGCCCCTGAATATAGTAAAGGAAGAGGCTGAG
GAGGACATGGTGGCTGATCTTCTCCCGGGCGCCCGTGCAATGAAGCGTCGTCGTGCAGATATGACTCGCCATCAC
CCAGAGGATGAGGCCGTAGCCCCCGAATCGGAGGCCCCGAAACGCAAGCGACCTAAACTTGACGTGCTCGAAGCC
GCGCGAAAGCACCGTGAAGAAGAAGAACAACAACGCAAGGCCGAAGAAGACTCACATTCAGCCGATGTAGGTGAT
GTGGATGTGGACAAATTGAAGAACCTGGCTATTGTGGAAGAAATGGAGATTCCCGTCCGGAACGCACCAGCGCAC
GAGCATGACAGTTCGGACAGATGGGATGATCAATGGAATGGGCGCAAGAATTTCAAGAAGTTCCGGCGAAAAGGC
GAGCCGCGTAGTCGAGCTCGCATCCAGACAGTGATCGTCCCCTTAGAAGAAGTGACCCGCAAAGACTATGGAATT
GGCGATCACTATTGGGGTGGCAATCCTGCTGAGACTTACCCTCAGAACGAGGCTGGAGGTCCTGAATCTGATCAT
CACGATGAAGTTGCTCCATCACGGTCCAAGCTGTCAGCGATTACACGCACCTCGCTTCAACCGACCTCGGACCCA
ACTCCGGCTCGGCCCCCGAAGAGGGCTCGCGAGGAGCGCGATTCGGACAGCGATGATGAACTTCGTTTCCGTTTC
AGGCGTAAGCGCTAG
Gene >Pro_DTO377G3_2|g8413.t1
ATGTGGATTCTTGATTCGACCGGTGATTTTCTGGAAGGTGGGAATATTTGATTGACAAGGATCGATTGGTTGCTA
AAGCCTCATAGGGAAGCGCGTGTGGCTGCGCCCTGGAAAGAGGTATCTATTCGGTCGATTCCATCGAGACGGAGG
TATGGCCTACTTCAGTTGGAGCATCACACAGTTCGGCTGATCTCTTATTGAATAGTCCGCCATGCTGTCAATCAT
AATTCGATATCCCGCAAGCATATGACCATTGAAATCTCACCGGTCAGTCCGCGAGATGGGGTACGGTTGAACTCC
CCGCGACGATATGCATTATCTGGCTAATACCCCTCCAGTTGTCACTACGAGCGCGATCCAATATCACCATAACCG
ATTTAGACTCGAAGAAAGGAACAGTCGTTGACGAGAGGAGAATCCAAGGAGAATGCAAGTTGGAGAAGAGCGATG
AGCATCTCATCCAGCTCGCTAAATACCAGCATGCGCTCCGGTGCGTATGTCTTCTTACGATTGGCTTGAATCCCG
GCTGATGCTCTTGATAGGATCAAATGGGAGCCCGTGGTTCTGACCTTGTCATCCTCCTCCAAGCAGGTGCGAGGT
GAAGATCCTCTAGCCCATGTTCGCTCACGTCTAGAAGACCTCGACATTAAGACCATCATGGATTATATTGTCGAT
CACACAACACATGTGGTACAGCGCAAACGGAATACAGCTAAGGGTCTTCAGGCACTCGTCAACGGGAAGTACATA
GTAGATGATTCATATATCGATGCACTCGTCTACGCGGCTACCCCCGGGGATCTTGAGAACATTGAGTCGCTATGT
CCACTTGAAACCGACTTCGAATTAGCATGGCCCGATCCAAATCAACACCTTCCGCCCCCCGGGAAAGAACCAACC
CAGCGTCCCGCCGCTGCTTTCGCTCCCAATCCCGCACGTATTAATGTCTTTGAGGGATATACGTTTATTTTCGGT
GATCCAAGCCAGTTTGAAAACCTACAAGGTCCAATCAACAATGGCCAAGGGAAGGCGCTCCTCTACGAAATTGAA
GATGGGGTCACAACTGCCGCAGATATTGTTCGGTTTATAAAAAAGGCAGCAGGACAGAAAGGCGTGGGCCCCGAG
CGACACGGTTCCGGTGGCGTCGTTCTTGTTCGCTTTCGATCGAAAGGAGACCTCGAACAATGGTCTATTGACGTC
GGTAATGAGGTTGCTCTAATGATGGACCAGCGCGTGATAGAGCAACGAGAGTTCCTTGACGCTATCCTTGGAAAT
GATGCATCACCCCTCTGCCGTACCTTGCCCACGGAGGAGAGCTCTAGTCAGATCACCGCATCTACACCCGCGGTC
GAGGCTGAACAAACAAGCCAACAAGCAGTTTCTGCCGTACCTGAATCGGTAGATCTGCCTAACTCTGAGCCTAGT
CAACCCTCGAAAGCTCCGGCCAAGACCCGTGTGCGTGCATACGTCAGTAAAATGAAAACCTTCGATGACGGATTC
GACATGGAATCTGTCCCAGTGTATGCACCTGAAGAAGAGGACACCAATATCAACTCCACTCAAACCATCGATATC
GAAACTCAAGCGCCATCTCAAGAAATCCAGCCCCTGAATATAGTAAAGGAAGAGGCTGAGGAGGACATGGTGGCT
GATCTTCTCCCGGGCGCCCGTGCAATGAAGCGTCGTCGTGCAGATATGACTCGCCATCACCCAGAGGATGAGGCC
GTAGCCCCCGAATCGGAGGCCCCGAAACGCAAGCGACCTAAACTTGACGTGCTCGAAGCCGCGCGAAAGCACCGT
GAAGAAGAAGAACAACAACGCAAGGCCGAAGAAGACTCACATTCAGCCGATGTAGGTGATGTGGATGTGGACAAA
TTGAAGAACCTGGCTATTGTGGAAGAAATGGAGATTCCCGTCCGGAACGCACCAGCGCACGAGCATGACAGTTCG
GACAGATGGGATGATCAATGGAATGGGCGCAAGAATTTCAAGAAGTTCCGGCGAAAAGGCGAGCCGCGTAGTCGA
GCTCGCATCCAGACAGTGATCGTCCCCTTAGAAGAAGTGACCCGCAAAGACTATGGAATTGGCGATCACTATTGG
GGTGGCAATCCTGCTGAGACTTACCCTCAGAACGAGGCTGGAGGTCCTGAATCTGATCATCACGATGAAGTTGCT
CCATCACGGTCCAAGCTGTCAGCGATTACACGCACCTCGCTTCAACCGACCTCGGACCCAACTCCGGCTCGGCCC
CCGAAGAGGGCTCGCGAGGAGCGCGATTCGGACAGCGATGATGAACTTCGTTTCCGTTTCAGGCGTAAGCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail