Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8374.t1
Gene name
Locationscaffold_32:68815..72230
Strand-
Gene length (bp)3415
Transcript length (bp)3354
Coding sequence length (bp)3354
Protein length (aa) 1118

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 4.8E-07 287 355
PF06011 TRP Transient receptor potential (TRP) ion channel 2.1E-32 372 637
PF14558 TRP_N ML-like domain 1.7E-14 75 252

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 258 280 22
3 392 414 22
4 440 462 22
5 472 494 22
6 547 569 22
7 584 606 22
8 611 633 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8374.t1
MPEVDMHDSTEIELDGHSSSSRRKASRRPRRSGLHILQGRPWPDTSKRRAQPWSSVWWIALLYLVSFASPGAAVL
LDFENCLSKSILESDPLQLQFVPTNVSVKFNLTNPLHPLAITVYGNVSGTTSQTADYPAPDSSVWTNPNWTDGKI
EDVSTTNNKYSTLMTDLNVLSFTPFSNASRFRDAVTQGTLPLGPVFNYNMSDLTTLRAFSVQHDMLSTYRFGTIT
PLLIVRSGDASAVQLACVLVNATPDLGTSLKSAIAYVPLIILILVGIATITAAMFSPWGTTDLFRWTSNYGRDED
VLRLVTPGFADCLQYLQFIVLTGSLSLNYPGFFQPIVSQGAWSTLMFNQSFVSTEIGRDPVVDGLYAINGTYGLD
RMNHLVGMASSQDIWPGMIIWVLVIMACVTVVFQIAFALRWLYRELANNTDQDLRARNMPFTMGNLIRIVFNFLL
LPIVSLSFFQLVIARQSTAYCVALAAVVIVIIACFAIWAIRVVLNTRPKAHLFDDLPTVLLYGPLYNTYCDDAAA
FGIVPIVLNIARGIAIGALQPSGIAQVVMLAICEVVSVLTLLAFRPFSRPTHMNLYHCLFSIVRFLTVILSVVFV
PSLTLSDAARGWIGYLILVLHAVVLIFGFFLNAMQTLIEVLARLAGAGGATRGGLTKVLGMRQLSRRTPRRDLTR
QSMGSEAAMLGHGDDRMSSQFDGSRPRSLSGSSGLLLNRASDGRVSTIYDYPSSQGGTHSRAASGGFPTPTSTTY
QGAGFPSSPSSGKMMGTNPRDPYYRPPRPGRRTPPASGALAKGKSPSRGFLKSKSSRRAVSIDDDLGDGMSGRAT
PVPAYLATPKDDMELDTPRKPKDYAVREVDFYYGVRGPPLSHSGTRKLKTGPADPTGPVSSATGWFRSLLQGKTK
DNAKGFEVVRSARAPPPGLFPRRDDFNDPYQDDIGMPSASHSREVSTGNVPYQDSDNDHDPEPSCPPVLPQINTS
GGGGIELPSRTASCHTQAPGDQDAGTAAGLPVVTETLSHNSDISQHYEHSEHHLQPEGSTTARLPFSGSSSPSRE
RGLSMTSTSRSRSNASSQQTGARPSSLGYVPQHRAHDHIHEGSPDEPSFKGSAAELVDEASLGGHER*
Coding >Pro_DTO377G3_2|g8374.t1
ATGCCCGAAGTGGACATGCACGACTCGACGGAGATCGAGCTGGACGGACATTCATCATCCTCTCGACGGAAAGCA
AGCAGGCGGCCGCGACGCAGTGGATTACACATTTTGCAAGGTCGGCCGTGGCCCGACACTTCGAAACGCCGAGCA
CAACCATGGAGTTCGGTGTGGTGGATTGCACTGCTGTACTTAGTGAGCTTTGCATCGCCAGGGGCTGCTGTTCTT
TTGGACTTTGAAAATTGTCTATCAAAATCCATCCTCGAGTCCGACCCTCTACAACTTCAATTCGTTCCTACCAAC
GTGTCCGTCAAATTCAACCTTACCAACCCTCTACACCCGCTCGCCATCACGGTCTATGGCAATGTGTCGGGAACC
ACGTCTCAAACCGCAGACTATCCCGCACCCGATTCCTCTGTATGGACAAATCCCAATTGGACCGATGGGAAGATT
GAGGATGTGAGCACTACCAACAACAAGTACAGCACGCTGATGACGGATCTCAATGTGCTTAGCTTCACGCCCTTT
AGCAATGCCTCTCGTTTCCGTGACGCGGTCACTCAGGGCACCCTCCCGCTGGGTCCGGTCTTTAATTACAATATG
AGTGATTTGACCACATTACGAGCGTTCTCGGTTCAACATGATATGCTTTCAACTTACCGTTTCGGAACTATCACA
CCCTTATTGATAGTTCGCTCTGGAGATGCATCCGCCGTTCAGCTCGCCTGCGTTTTGGTGAACGCGACGCCGGAC
TTGGGAACATCTCTCAAAAGTGCCATTGCCTATGTGCCTCTCATCATTTTGATACTGGTGGGAATTGCGACCATC
ACGGCCGCCATGTTTAGCCCTTGGGGCACAACCGATCTATTTCGGTGGACAAGCAACTACGGCCGCGATGAAGAT
GTTCTCCGACTTGTCACTCCTGGATTTGCAGATTGCCTGCAATACCTTCAATTCATAGTATTAACGGGCTCGCTT
TCTTTGAATTACCCAGGTTTCTTCCAGCCTATAGTGAGTCAGGGAGCATGGTCGACTCTCATGTTCAACCAGAGT
TTCGTCAGCACTGAAATCGGCCGCGATCCCGTTGTGGATGGTCTATATGCCATCAATGGAACGTATGGCCTCGAC
CGAATGAACCACCTGGTTGGCATGGCCTCATCTCAGGATATCTGGCCTGGTATGATCATATGGGTGCTGGTAATC
ATGGCTTGTGTGACGGTGGTCTTCCAGATCGCATTCGCGCTCCGATGGCTGTATCGTGAGTTGGCAAACAACACC
GATCAGGATCTGCGTGCCAGAAACATGCCGTTCACCATGGGGAATCTCATTCGCATTGTCTTCAATTTTCTTCTC
TTGCCAATCGTTTCCCTTTCCTTCTTCCAATTGGTTATTGCTCGTCAATCAACCGCTTACTGTGTTGCTTTGGCG
GCCGTGGTGATCGTTATTATTGCTTGCTTCGCGATTTGGGCTATCCGTGTGGTCCTTAACACTCGACCCAAAGCT
CACCTTTTCGATGATCTTCCTACAGTGCTATTGTATGGGCCGCTCTATAATACATACTGTGACGATGCAGCAGCC
TTTGGTATCGTCCCAATTGTATTGAACATCGCTCGCGGAATAGCCATTGGTGCTTTGCAGCCGTCTGGTATCGCC
CAAGTGGTAATGCTGGCCATTTGCGAAGTTGTGTCTGTACTAACCCTGCTGGCCTTCCGACCTTTCTCAAGACCA
ACCCACATGAACCTGTATCACTGCCTCTTCTCTATTGTGCGTTTCTTGACAGTTATTTTGAGCGTTGTCTTTGTG
CCGTCATTGACACTTTCGGATGCGGCCAGAGGCTGGATCGGATATCTGATCCTTGTGCTGCACGCCGTGGTTCTC
ATTTTCGGGTTCTTCCTCAACGCAATGCAAACCTTGATCGAAGTACTGGCAAGACTGGCTGGTGCGGGCGGTGCC
ACTCGTGGTGGCTTGACGAAGGTGCTTGGCATGCGCCAGCTCTCGAGGCGCACTCCGCGACGTGATCTTACTCGC
CAGAGTATGGGTTCGGAGGCTGCTATGCTTGGTCACGGTGACGATCGTATGTCATCTCAGTTTGATGGATCGCGT
CCTCGCAGTCTCTCTGGGAGCTCTGGTCTGCTTTTGAACCGTGCTAGTGATGGCAGAGTCAGCACCATCTATGAT
TATCCCAGTTCGCAAGGAGGCACACACAGCCGTGCTGCTAGCGGGGGATTCCCCACACCTACCTCAACCACCTAT
CAAGGAGCTGGCTTCCCTAGCTCGCCCAGTAGTGGTAAGATGATGGGAACAAACCCTCGTGATCCCTATTACCGG
CCACCTCGCCCCGGGCGAAGAACGCCCCCAGCAAGTGGTGCTCTCGCGAAGGGGAAGAGCCCGTCAAGAGGCTTC
TTGAAATCAAAATCAAGCCGCCGAGCAGTCAGCATCGATGACGACCTGGGAGATGGCATGTCTGGCCGTGCTACA
CCAGTTCCAGCATATCTAGCAACGCCGAAGGATGATATGGAGCTCGATACCCCTCGCAAGCCGAAGGATTATGCT
GTTCGCGAGGTTGATTTCTACTATGGTGTCCGAGGCCCACCGCTCTCCCACAGCGGTACGCGAAAGTTGAAAACT
GGCCCAGCCGACCCCACAGGTCCAGTCTCGTCTGCGACGGGCTGGTTCCGAAGCTTGCTCCAAGGGAAGACGAAG
GACAACGCCAAAGGATTTGAGGTGGTCCGAAGTGCTCGTGCGCCTCCTCCAGGTCTATTCCCGAGAAGAGACGAC
TTTAATGATCCTTATCAGGATGATATAGGCATGCCATCAGCCAGTCATTCTCGGGAAGTGTCTACCGGCAATGTT
CCCTATCAGGATTCGGACAATGACCACGACCCCGAACCGTCATGCCCGCCAGTACTGCCACAAATTAATACCTCA
GGTGGCGGTGGTATCGAATTGCCCAGTCGGACGGCCTCTTGCCACACACAGGCGCCTGGTGACCAAGACGCAGGA
ACTGCGGCTGGCCTTCCAGTTGTGACCGAGACCCTGTCTCACAACTCTGATATAAGCCAGCACTACGAGCACTCC
GAGCACCATCTCCAGCCAGAAGGCTCCACCACCGCGCGCCTGCCTTTCAGCGGAAGTAGCTCGCCATCTCGTGAA
CGAGGTCTGTCTATGACCTCTACTTCAAGGTCAAGATCAAACGCCTCGAGCCAGCAGACGGGTGCTCGACCCTCG
AGTCTGGGCTATGTACCTCAACATCGCGCGCACGACCACATCCACGAGGGGAGCCCCGACGAGCCATCCTTTAAG
GGGAGCGCAGCAGAACTTGTCGATGAAGCTTCGCTGGGCGGGCACGAGCGTTAA
Transcript >Pro_DTO377G3_2|g8374.t1
ATGCCCGAAGTGGACATGCACGACTCGACGGAGATCGAGCTGGACGGACATTCATCATCCTCTCGACGGAAAGCA
AGCAGGCGGCCGCGACGCAGTGGATTACACATTTTGCAAGGTCGGCCGTGGCCCGACACTTCGAAACGCCGAGCA
CAACCATGGAGTTCGGTGTGGTGGATTGCACTGCTGTACTTAGTGAGCTTTGCATCGCCAGGGGCTGCTGTTCTT
TTGGACTTTGAAAATTGTCTATCAAAATCCATCCTCGAGTCCGACCCTCTACAACTTCAATTCGTTCCTACCAAC
GTGTCCGTCAAATTCAACCTTACCAACCCTCTACACCCGCTCGCCATCACGGTCTATGGCAATGTGTCGGGAACC
ACGTCTCAAACCGCAGACTATCCCGCACCCGATTCCTCTGTATGGACAAATCCCAATTGGACCGATGGGAAGATT
GAGGATGTGAGCACTACCAACAACAAGTACAGCACGCTGATGACGGATCTCAATGTGCTTAGCTTCACGCCCTTT
AGCAATGCCTCTCGTTTCCGTGACGCGGTCACTCAGGGCACCCTCCCGCTGGGTCCGGTCTTTAATTACAATATG
AGTGATTTGACCACATTACGAGCGTTCTCGGTTCAACATGATATGCTTTCAACTTACCGTTTCGGAACTATCACA
CCCTTATTGATAGTTCGCTCTGGAGATGCATCCGCCGTTCAGCTCGCCTGCGTTTTGGTGAACGCGACGCCGGAC
TTGGGAACATCTCTCAAAAGTGCCATTGCCTATGTGCCTCTCATCATTTTGATACTGGTGGGAATTGCGACCATC
ACGGCCGCCATGTTTAGCCCTTGGGGCACAACCGATCTATTTCGGTGGACAAGCAACTACGGCCGCGATGAAGAT
GTTCTCCGACTTGTCACTCCTGGATTTGCAGATTGCCTGCAATACCTTCAATTCATAGTATTAACGGGCTCGCTT
TCTTTGAATTACCCAGGTTTCTTCCAGCCTATAGTGAGTCAGGGAGCATGGTCGACTCTCATGTTCAACCAGAGT
TTCGTCAGCACTGAAATCGGCCGCGATCCCGTTGTGGATGGTCTATATGCCATCAATGGAACGTATGGCCTCGAC
CGAATGAACCACCTGGTTGGCATGGCCTCATCTCAGGATATCTGGCCTGGTATGATCATATGGGTGCTGGTAATC
ATGGCTTGTGTGACGGTGGTCTTCCAGATCGCATTCGCGCTCCGATGGCTGTATCGTGAGTTGGCAAACAACACC
GATCAGGATCTGCGTGCCAGAAACATGCCGTTCACCATGGGGAATCTCATTCGCATTGTCTTCAATTTTCTTCTC
TTGCCAATCGTTTCCCTTTCCTTCTTCCAATTGGTTATTGCTCGTCAATCAACCGCTTACTGTGTTGCTTTGGCG
GCCGTGGTGATCGTTATTATTGCTTGCTTCGCGATTTGGGCTATCCGTGTGGTCCTTAACACTCGACCCAAAGCT
CACCTTTTCGATGATCTTCCTACAGTGCTATTGTATGGGCCGCTCTATAATACATACTGTGACGATGCAGCAGCC
TTTGGTATCGTCCCAATTGTATTGAACATCGCTCGCGGAATAGCCATTGGTGCTTTGCAGCCGTCTGGTATCGCC
CAAGTGGTAATGCTGGCCATTTGCGAAGTTGTGTCTGTACTAACCCTGCTGGCCTTCCGACCTTTCTCAAGACCA
ACCCACATGAACCTGTATCACTGCCTCTTCTCTATTGTGCGTTTCTTGACAGTTATTTTGAGCGTTGTCTTTGTG
CCGTCATTGACACTTTCGGATGCGGCCAGAGGCTGGATCGGATATCTGATCCTTGTGCTGCACGCCGTGGTTCTC
ATTTTCGGGTTCTTCCTCAACGCAATGCAAACCTTGATCGAAGTACTGGCAAGACTGGCTGGTGCGGGCGGTGCC
ACTCGTGGTGGCTTGACGAAGGTGCTTGGCATGCGCCAGCTCTCGAGGCGCACTCCGCGACGTGATCTTACTCGC
CAGAGTATGGGTTCGGAGGCTGCTATGCTTGGTCACGGTGACGATCGTATGTCATCTCAGTTTGATGGATCGCGT
CCTCGCAGTCTCTCTGGGAGCTCTGGTCTGCTTTTGAACCGTGCTAGTGATGGCAGAGTCAGCACCATCTATGAT
TATCCCAGTTCGCAAGGAGGCACACACAGCCGTGCTGCTAGCGGGGGATTCCCCACACCTACCTCAACCACCTAT
CAAGGAGCTGGCTTCCCTAGCTCGCCCAGTAGTGGTAAGATGATGGGAACAAACCCTCGTGATCCCTATTACCGG
CCACCTCGCCCCGGGCGAAGAACGCCCCCAGCAAGTGGTGCTCTCGCGAAGGGGAAGAGCCCGTCAAGAGGCTTC
TTGAAATCAAAATCAAGCCGCCGAGCAGTCAGCATCGATGACGACCTGGGAGATGGCATGTCTGGCCGTGCTACA
CCAGTTCCAGCATATCTAGCAACGCCGAAGGATGATATGGAGCTCGATACCCCTCGCAAGCCGAAGGATTATGCT
GTTCGCGAGGTTGATTTCTACTATGGTGTCCGAGGCCCACCGCTCTCCCACAGCGGTACGCGAAAGTTGAAAACT
GGCCCAGCCGACCCCACAGGTCCAGTCTCGTCTGCGACGGGCTGGTTCCGAAGCTTGCTCCAAGGGAAGACGAAG
GACAACGCCAAAGGATTTGAGGTGGTCCGAAGTGCTCGTGCGCCTCCTCCAGGTCTATTCCCGAGAAGAGACGAC
TTTAATGATCCTTATCAGGATGATATAGGCATGCCATCAGCCAGTCATTCTCGGGAAGTGTCTACCGGCAATGTT
CCCTATCAGGATTCGGACAATGACCACGACCCCGAACCGTCATGCCCGCCAGTACTGCCACAAATTAATACCTCA
GGTGGCGGTGGTATCGAATTGCCCAGTCGGACGGCCTCTTGCCACACACAGGCGCCTGGTGACCAAGACGCAGGA
ACTGCGGCTGGCCTTCCAGTTGTGACCGAGACCCTGTCTCACAACTCTGATATAAGCCAGCACTACGAGCACTCC
GAGCACCATCTCCAGCCAGAAGGCTCCACCACCGCGCGCCTGCCTTTCAGCGGAAGTAGCTCGCCATCTCGTGAA
CGAGGTCTGTCTATGACCTCTACTTCAAGGTCAAGATCAAACGCCTCGAGCCAGCAGACGGGTGCTCGACCCTCG
AGTCTGGGCTATGTACCTCAACATCGCGCGCACGACCACATCCACGAGGGGAGCCCCGACGAGCCATCCTTTAAG
GGGAGCGCAGCAGAACTTGTCGATGAAGCTTCGCTGGGCGGGCACGAGCGTTAA
Gene >Pro_DTO377G3_2|g8374.t1
ATGCCCGAAGTGGACATGCACGACTCGACGGAGATCGAGCTGGACGGACATTCATCATCCTCTCGACGGAAAGCA
AGCAGGCGGCCGCGACGCAGTGGATTACACATTTTGCAAGGTCGGCCGTGGCCCGACACTTCGAAACGCCGAGCA
CAACCATGGAGTTCGGTGTGGTGGATTGCACTGCTGTACTTAGTGAGCTTTGCATCGCCAGGGGCTGCTGTTCTT
TTGGACTTTGAAAATTGTCTATCAAAATCCATCCTCGAGTCCGACCCTCTACAACTTCAATTCGTTCCTACCAAC
GTGTCCGTCAAATTCAACCTTACCAACCCTCTACACCCGCTCGCCATCACGGTCTATGGCAATGTGTCGGGAACC
ACGTCTCAAACCGCAGACTATCCCGCACCCGATTCCTCTGTATGGACAAATCCCAATTGGACCGATGGGAAGATT
GAGGATGTGAGCACTACCAACAACAAGTACAGCACGCTGATGACGGATCTCAATGTGCTTAGCTTCACGCCCTTT
AGCAATGCCTCTCGTTTCCGTGACGCGGTCACTCAGGGCACCCTCCCGCTGGGTCCGGTCTTTAATTACAATATG
TAAGCTATTGCAGGAAGAGAAAGCTCTGCGATTTTTAACTAATCCCTTTCTCTTATGCAGGAGTGATTTGACCAC
ATTACGAGCGTTCTCGGTTCAACATGATATGCTTTCAACTTACCGTTTCGGAACTATCACACCCTTATTGATAGT
TCGCTCTGGAGATGCATCCGCCGTTCAGCTCGCCTGCGTTTTGGTGAACGCGACGCCGGACTTGGGAACATCTCT
CAAAAGTGCCATTGCCTATGTGCCTCTCATCATTTTGATACTGGTGGGAATTGCGACCATCACGGCCGCCATGTT
TAGCCCTTGGGGCACAACCGATCTATTTCGGTGGACAAGCAACTACGGCCGCGATGAAGATGTTCTCCGACTTGT
CACTCCTGGATTTGCAGATTGCCTGCAATACCTTCAATTCATAGTATTAACGGGCTCGCTTTCTTTGAATTACCC
AGGTTTCTTCCAGCCTATAGTGAGTCAGGGAGCATGGTCGACTCTCATGTTCAACCAGAGTTTCGTCAGCACTGA
AATCGGCCGCGATCCCGTTGTGGATGGTCTATATGCCATCAATGGAACGTATGGCCTCGACCGAATGAACCACCT
GGTTGGCATGGCCTCATCTCAGGATATCTGGCCTGGTATGATCATATGGGTGCTGGTAATCATGGCTTGTGTGAC
GGTGGTCTTCCAGATCGCATTCGCGCTCCGATGGCTGTATCGTGAGTTGGCAAACAACACCGATCAGGATCTGCG
TGCCAGAAACATGCCGTTCACCATGGGGAATCTCATTCGCATTGTCTTCAATTTTCTTCTCTTGCCAATCGTTTC
CCTTTCCTTCTTCCAATTGGTTATTGCTCGTCAATCAACCGCTTACTGTGTTGCTTTGGCGGCCGTGGTGATCGT
TATTATTGCTTGCTTCGCGATTTGGGCTATCCGTGTGGTCCTTAACACTCGACCCAAAGCTCACCTTTTCGATGA
TCTTCCTACAGTGCTATTGTATGGGCCGCTCTATAATACATACTGTGACGATGCAGCAGCCTTTGGTATCGTCCC
AATTGTATTGAACATCGCTCGCGGAATAGCCATTGGTGCTTTGCAGCCGTCTGGTATCGCCCAAGTGGTAATGCT
GGCCATTTGCGAAGTTGTGTCTGTACTAACCCTGCTGGCCTTCCGACCTTTCTCAAGACCAACCCACATGAACCT
GTATCACTGCCTCTTCTCTATTGTGCGTTTCTTGACAGTTATTTTGAGCGTTGTCTTTGTGCCGTCATTGACACT
TTCGGATGCGGCCAGAGGCTGGATCGGATATCTGATCCTTGTGCTGCACGCCGTGGTTCTCATTTTCGGGTTCTT
CCTCAACGCAATGCAAACCTTGATCGAAGTACTGGCAAGACTGGCTGGTGCGGGCGGTGCCACTCGTGGTGGCTT
GACGAAGGTGCTTGGCATGCGCCAGCTCTCGAGGCGCACTCCGCGACGTGATCTTACTCGCCAGAGTATGGGTTC
GGAGGCTGCTATGCTTGGTCACGGTGACGATCGTATGTCATCTCAGTTTGATGGATCGCGTCCTCGCAGTCTCTC
TGGGAGCTCTGGTCTGCTTTTGAACCGTGCTAGTGATGGCAGAGTCAGCACCATCTATGATTATCCCAGTTCGCA
AGGAGGCACACACAGCCGTGCTGCTAGCGGGGGATTCCCCACACCTACCTCAACCACCTATCAAGGAGCTGGCTT
CCCTAGCTCGCCCAGTAGTGGTAAGATGATGGGAACAAACCCTCGTGATCCCTATTACCGGCCACCTCGCCCCGG
GCGAAGAACGCCCCCAGCAAGTGGTGCTCTCGCGAAGGGGAAGAGCCCGTCAAGAGGCTTCTTGAAATCAAAATC
AAGCCGCCGAGCAGTCAGCATCGATGACGACCTGGGAGATGGCATGTCTGGCCGTGCTACACCAGTTCCAGCATA
TCTAGCAACGCCGAAGGATGATATGGAGCTCGATACCCCTCGCAAGCCGAAGGATTATGCTGTTCGCGAGGTTGA
TTTCTACTATGGTGTCCGAGGCCCACCGCTCTCCCACAGCGGTACGCGAAAGTTGAAAACTGGCCCAGCCGACCC
CACAGGTCCAGTCTCGTCTGCGACGGGCTGGTTCCGAAGCTTGCTCCAAGGGAAGACGAAGGACAACGCCAAAGG
ATTTGAGGTGGTCCGAAGTGCTCGTGCGCCTCCTCCAGGTCTATTCCCGAGAAGAGACGACTTTAATGATCCTTA
TCAGGATGATATAGGCATGCCATCAGCCAGTCATTCTCGGGAAGTGTCTACCGGCAATGTTCCCTATCAGGATTC
GGACAATGACCACGACCCCGAACCGTCATGCCCGCCAGTACTGCCACAAATTAATACCTCAGGTGGCGGTGGTAT
CGAATTGCCCAGTCGGACGGCCTCTTGCCACACACAGGCGCCTGGTGACCAAGACGCAGGAACTGCGGCTGGCCT
TCCAGTTGTGACCGAGACCCTGTCTCACAACTCTGATATAAGCCAGCACTACGAGCACTCCGAGCACCATCTCCA
GCCAGAAGGCTCCACCACCGCGCGCCTGCCTTTCAGCGGAAGTAGCTCGCCATCTCGTGAACGAGGTCTGTCTAT
GACCTCTACTTCAAGGTCAAGATCAAACGCCTCGAGCCAGCAGACGGGTGCTCGACCCTCGAGTCTGGGCTATGT
ACCTCAACATCGCGCGCACGACCACATCCACGAGGGGAGCCCCGACGAGCCATCCTTTAAGGGGAGCGCAGCAGA
ACTTGTCGATGAAGCTTCGCTGGGCGGGCACGAGCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail