Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8365.t1
Gene name
Locationscaffold_32:47032..47350
Strand+
Gene length (bp)318
Transcript length (bp)264
Coding sequence length (bp)264
Protein length (aa) 88

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 456.82 241.43 672.20
5d_25C Five days - 25 degrees Celsius 407.45 206.30 608.60
7d_25C Seven days - 25 degrees Celsius 321.16 150.45 491.87
10d_25C Ten days - 25 degrees Celsius 181.16 65.02 297.30
7d_15C Seven days - 15 degrees Celsius 295.72 122.28 469.16
7d_30C Seven days - 30 degrees Celsius 253.68 112.72 394.64

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.749691 no
3d_25C 7d_25C 0.240797 no
3d_25C 7d_15C 0.140796 no
3d_25C 7d_30C 0.037981 yes
3d_25C 10d_25C 0.003197 yes
5d_25C 7d_25C 0.474026 no
5d_25C 7d_15C 0.307465 no
5d_25C 7d_30C 0.100869 no
5d_25C 10d_25C 0.009124 yes
7d_25C 7d_15C 0.854139 no
7d_25C 7d_30C 0.517396 no
7d_25C 10d_25C 0.085662 no
7d_15C 7d_30C 0.708897 no
7d_15C 10d_25C 0.157291 no
7d_30C 10d_25C 0.368216 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8365.t1
MALVRDPYFWKRFSTAVHMDEESKAIDRAQAKQDAASWLTRERMKSKRSIICGFIIFFAVVLVIVVSVVLWWLAK
NNWLQPHPDTAQ*
Coding >Pro_DTO377G3_2|g8365.t1
ATGGCTCTTGTTCGAGACCCATATTTCTGGAAACGGTTCTCAACTGCAGTCCACATGGACGAAGAGTCAAAAGCA
ATTGACCGGGCACAAGCAAAACAGGATGCGGCATCATGGCTTACCCGCGAAAGAATGAAGAGCAAGCGTTCGATC
ATTTGCGGCTTCATCATTTTTTTCGCCGTCGTGCTCGTCATCGTTGTCAGCGTGGTCCTATGGTGGCTTGCTAAG
AACAACTGGCTCCAGCCTCATCCGGATACTGCTCAATAA
Transcript >Pro_DTO377G3_2|g8365.t1
ATGGCTCTTGTTCGAGACCCATATTTCTGGAAACGGTTCTCAACTGCAGTCCACATGGACGAAGAGTCAAAAGCA
ATTGACCGGGCACAAGCAAAACAGGATGCGGCATCATGGCTTACCCGCGAAAGAATGAAGAGCAAGCGTTCGATC
ATTTGCGGCTTCATCATTTTTTTCGCCGTCGTGCTCGTCATCGTTGTCAGCGTGGTCCTATGGTGGCTTGCTAAG
AACAACTGGCTCCAGCCTCATCCGGATACTGCTCAATAA
Gene >Pro_DTO377G3_2|g8365.t1
ATGGCTCTTGTTCGAGACCCATATTTCTGGAAACGGTTCTCAACTGCAGTCCACATGGACGAAGAGTCAAAAGCA
ATTGACCGGGCACAAGCAAAACAGGATGCGTAAGATACCCTCATCTCCAATACATTTGTTGAACCTCAACTCACC
CCCTGTAGGGCATCATGGCTTACCCGCGAAAGAATGAAGAGCAAGCGTTCGATCATTTGCGGCTTCATCATTTTT
TTCGCCGTCGTGCTCGTCATCGTTGTCAGCGTGGTCCTATGGTGGCTTGCTAAGAACAACTGGCTCCAGCCTCAT
CCGGATACTGCTCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail