Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g831.t1
Gene name
Locationscaffold_01:2220486..2221806
Strand+
Gene length (bp)1320
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.9E-17 1 342
PF00083 Sugar_tr Sugar (and other) transporter 6.1E-06 40 130
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.4E-05 133 212

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 49 68 19
3 118 140 22
4 160 179 19
5 189 211 22
6 232 254 22
7 264 283 19
8 288 310 22
9 325 347 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6.53 2.10 10.97
5d_25C Five days - 25 degrees Celsius 7.49 2.55 12.42
7d_25C Seven days - 25 degrees Celsius 10.46 4.10 16.83
10d_25C Ten days - 25 degrees Celsius 13.76 5.79 21.74
7d_15C Seven days - 15 degrees Celsius 10.89 4.30 17.48
7d_30C Seven days - 30 degrees Celsius 7.80 2.69 12.92

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.786514 no
3d_25C 7d_25C 0.209425 no
3d_25C 7d_15C 0.165132 no
3d_25C 7d_30C 0.714338 no
3d_25C 10d_25C 0.030434 yes
5d_25C 7d_25C 0.388025 no
5d_25C 7d_15C 0.325602 no
5d_25C 7d_30C 0.942050 no
5d_25C 10d_25C 0.064497 no
7d_25C 7d_15C 0.940654 no
7d_25C 7d_30C 0.467754 no
7d_25C 10d_25C 0.483974 no
7d_15C 7d_30C 0.383092 no
7d_15C 10d_25C 0.558964 no
7d_30C 10d_25C 0.089334 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g831.t1
MLAVAIPAITDELFGTTLTAFWANISFTVAVVVIQPIYISFSDICGRKIPLYAAFALFGIGSIVFAVAKNMAVLI
VGRVLQGLGGGGLDVRGEVIVADITTLQERAVYIGLLSLPMATGCIAGPILGAVFIGIALFLAIFFMRLRPIDQS
LRSQLGRIDWLGMPLFTADCVLFALPLSWAGNMYTWGSFRTIVPLIIGVLILVGFAFYEGYQTDAVFRYRSRTAQ
MSLLGSFIHGFISILPFCCVVFVFTGIAAFAVDFFRRYIWEIWAGWVFLAVGCGIFSLWDRSSSVAMTAGFQVIA
GIGIGTIFSVPPIPMQASAAPDDQGLAMGIMVAFRLFGALIGLAVDATTFSSVFANRISGIDLPASLALLKDPVR
P*
Coding >Pro_DTO377G3_2|g831.t1
ATGTTGGCCGTTGCAATCCCGGCCATCACCGATGAACTTTTCGGCACGACCTTGACCGCGTTTTGGGCCAACATC
TCCTTCACAGTAGCAGTCGTGGTTATCCAGCCCATCTATATCAGTTTCTCAGATATCTGCGGTCGTAAGATCCCT
CTTTACGCGGCTTTTGCCCTTTTCGGTATTGGATCGATTGTCTTTGCCGTCGCGAAAAACATGGCAGTTCTGATT
GTGGGACGTGTTCTACAAGGACTGGGCGGAGGCGGACTCGACGTCCGAGGTGAGGTCATTGTCGCCGATATCACT
ACTCTGCAAGAGAGGGCTGTGTATATTGGGTTACTGTCGCTTCCAATGGCGACAGGGTGCATCGCGGGTCCTATT
CTCGGTGCAGTCTTTATCGGCATTGCCCTCTTCCTGGCTATTTTCTTTATGCGCCTAAGACCAATTGACCAGTCC
CTTCGCTCCCAGCTTGGGCGTATCGACTGGCTTGGAATGCCACTATTTACGGCCGATTGTGTTCTGTTCGCCCTA
CCACTCAGTTGGGCTGGGAATATGTACACCTGGGGATCGTTTCGAACGATTGTTCCGCTTATCATTGGTGTTTTG
ATTTTGGTGGGATTTGCATTTTACGAGGGTTATCAGACCGACGCTGTCTTCCGCTACCGTTCCAGAACGGCACAA
ATGTCTCTGCTTGGAAGCTTCATCCATGGCTTCATCTCAATCTTACCATTCTGCTGTGTGGTATTTGTCTTTACC
GGAATTGCCGCCTTCGCCGTTGACTTCTTTCGGAGATACATATGGGAGATTTGGGCTGGATGGGTTTTCCTCGCC
GTTGGCTGTGGTATCTTCTCACTGTGGGATCGATCTTCTTCAGTAGCCATGACTGCTGGCTTCCAGGTGATTGCG
GGGATCGGCATTGGCACAATCTTCAGCGTCCCTCCCATCCCAATGCAAGCCAGCGCTGCACCCGATGACCAGGGT
CTCGCAATGGGAATAATGGTCGCGTTCAGGCTATTCGGTGCTCTTATTGGTCTTGCAGTTGATGCCACTACATTC
AGCAGTGTCTTCGCCAACAGGATTAGCGGTATCGATTTACCTGCTTCTTTGGCATTGTTGAAAGACCCAGTGAGG
CCGTAA
Transcript >Pro_DTO377G3_2|g831.t1
ATGTTGGCCGTTGCAATCCCGGCCATCACCGATGAACTTTTCGGCACGACCTTGACCGCGTTTTGGGCCAACATC
TCCTTCACAGTAGCAGTCGTGGTTATCCAGCCCATCTATATCAGTTTCTCAGATATCTGCGGTCGTAAGATCCCT
CTTTACGCGGCTTTTGCCCTTTTCGGTATTGGATCGATTGTCTTTGCCGTCGCGAAAAACATGGCAGTTCTGATT
GTGGGACGTGTTCTACAAGGACTGGGCGGAGGCGGACTCGACGTCCGAGGTGAGGTCATTGTCGCCGATATCACT
ACTCTGCAAGAGAGGGCTGTGTATATTGGGTTACTGTCGCTTCCAATGGCGACAGGGTGCATCGCGGGTCCTATT
CTCGGTGCAGTCTTTATCGGCATTGCCCTCTTCCTGGCTATTTTCTTTATGCGCCTAAGACCAATTGACCAGTCC
CTTCGCTCCCAGCTTGGGCGTATCGACTGGCTTGGAATGCCACTATTTACGGCCGATTGTGTTCTGTTCGCCCTA
CCACTCAGTTGGGCTGGGAATATGTACACCTGGGGATCGTTTCGAACGATTGTTCCGCTTATCATTGGTGTTTTG
ATTTTGGTGGGATTTGCATTTTACGAGGGTTATCAGACCGACGCTGTCTTCCGCTACCGTTCCAGAACGGCACAA
ATGTCTCTGCTTGGAAGCTTCATCCATGGCTTCATCTCAATCTTACCATTCTGCTGTGTGGTATTTGTCTTTACC
GGAATTGCCGCCTTCGCCGTTGACTTCTTTCGGAGATACATATGGGAGATTTGGGCTGGATGGGTTTTCCTCGCC
GTTGGCTGTGGTATCTTCTCACTGTGGGATCGATCTTCTTCAGTAGCCATGACTGCTGGCTTCCAGGTGATTGCG
GGGATCGGCATTGGCACAATCTTCAGCGTCCCTCCCATCCCAATGCAAGCCAGCGCTGCACCCGATGACCAGGGT
CTCGCAATGGGAATAATGGTCGCGTTCAGGCTATTCGGTGCTCTTATTGGTCTTGCAGTTGATGCCACTACATTC
AGCAGTGTCTTCGCCAACAGGATTAGCGGTATCGATTTACCTGCTTCTTTGGCATTGTTGAAAGACCCAGTGAGG
CCGTAA
Gene >Pro_DTO377G3_2|g831.t1
ATGTTGGCCGTTGCAATCCCGGTAATTCGATAACAACTCCTTCAATTCAAACGGCCATTGAGTTCACCTAACCCT
TCCTCTCTATAGGCCATCACCGATGAACTTTTCGGCACGACCTTGACCGCGTTTTGGGCCAACATCTCCTTCACA
GTAGCAGTCGTGGTTATCCAGCCCATCTATATCAGTTTCTCAGATATCTGCGGTCGTAAGATCCCTCTTTACGCG
GCTTTTGCCCTTTTCGGTATTGGATCGATTGTCTTTGCCGTCGCGAAAAACATGGCAGTTCTGATTGTGGGACGT
GTTCTACAAGGACTGGGCGGAGGCGGACTCGACGTCCGAGGTGAGGTCATTGTCGCCGATATCACTACTCTGCAA
GAGAGGGCTGTGTATATTGGGTTACTGTCGCTTCCAATGGCGACAGGGTGCATCGCGGGTCCTATTCTCGGTGCA
GTCTTTAGTGAGTTTGTTACGTGGAGATGGATCGGCTGGATTAATCTGCCTATAGTCGGCATTGCCCTCTTCCTG
GCTATTTTCTTTATGCGCCTAAGACCAATTGACCAGTCCCTTCGCTCCCAGCTTGGGCGTATCGACTGGCTTGGA
ATGCCACTATTTACGGCCGATTGTGTTCTGTTCGCCCTACCACTCAGTTGGGCTGGGAATATGTACACCTGGGGA
TCGTTTCGAACGATTGTTCCGCTTATCATTGGTGTTTTGATTTTGGTGGGATTTGCATTTTACGAGGGTTATCAG
ACCGACGCTGTCTTCCGCTACCGTTCCAGAACGGCACAAATGTCTCTGCTTGGAAGCTTCATCCATGGCTTCGTG
CTTTATACTCTTCTGCAATATCTTCCACTGTTTTTCCAAGCGGTCTACCTCGAATCACCGTTGAAATCTTAGATC
TCAATCTTACCATTCTGCTGTGTGGTATTTGTCTTTACCGGAATTGCCGCCTTCGCCGTTGACTTCTTTCGGAGA
TACATATGGGAGATTTGGGCTGGATGGGTTTTCCTCGCCGTTGGCTGTGGTATCTTCTCACTGTGGGATCGATCT
TCTTCAGTAGCCATGACTGCTGGCTTCCAGGTGATTGCGGGGATCGGCATTGGCACAATCTTCAGCGTCCCTCCC
ATCCCAATGCAAGCCAGCGCTGCACCCGATGACCAGGGTCTCGCAATGGGAATAATGGTCGCGTTCAGGCTATTC
GGTGCTCTTATTGGTCTTGCAGTTGATGCCACTACATTCAGCAGTGTCTTCGCCAACAGGATTAGCGGTATCGAT
TTACCTGCTTCTTTGGCATTGTTGAAAGACCCAGTGAGGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail