Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8300.t1
Gene name
Locationscaffold_31:124099..126413
Strand-
Gene length (bp)2314
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 8.6E-85 347 729

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 378 400 22
2 426 445 19
3 460 482 22
4 487 509 22
5 529 551 22
6 564 586 22
7 609 631 22
8 652 669 17
9 679 701 22
10 714 736 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8300.t1
MADNGEGPSLNPARSVPIASSSARSRSPAPEFGSRQASMARLASPVPSPSLGTSLSSRQGIPASRPVTNTTTEQE
FSRSIANPSSIPGPGHSILASQLQESLGRSPPRFGTPSRHNGSPAVHSTLDNRPLASQYGSFDTKNGVDSSSIAP
VEDPEVIKRHLVTEHTDNQSEIATSLGGEDTFSSLQLQGGDITRQVYRWAEDAEAEAAGRFLRSKSFSVSRPRPE
TDTEDIDTIRVPGGFRRDYLRRAAGSPHRGDAHGSNVGPPHGHGAPQLPTTSFLEFLTLYGHFAGEELEEDDEVL
GPDEYFSSDAWDEPDDGRESGEDAALLPPETPGRKKRKHKQRSPVGTTTTTGAVLLLLKSFVGTGILFLPRAFLN
GGMLFSSMVLLGVSILSYYAFILLVNTRTKIEGSFGDIGGILYGKHMRRIILGSIVLSQLGFVAAYIVFVSQNLQ
AFVLAVSRCATFIDIKYMVLLQLVIFLPLSLIRDISKLGFTALIADVFILLGLLYIYYYDISTLVDQGGISDIVS
FNPTTWSMFIGTAIFTYEGIGLIIPIQESMKQPNRFPGVLAGVMVLITFIFLSAGALSYAAYGSATKTVILLNLP
QDDKFVNVVQFLYSLAILLSTPLQLFPAIRIMENELFTRSGKYNPYIKWKKNGFRFFLVMVCALIAWCGANDLDK
FVSLVGSFACVPLIYVYPPLLHLRACAASKRQAVADVTLAVFGAICCVYTTYLTLMSWMGPDVPQSPGYCDSL*
Coding >Pro_DTO377G3_2|g8300.t1
ATGGCGGATAATGGCGAGGGTCCATCCCTAAATCCAGCTCGATCTGTGCCGATAGCCTCGTCCTCCGCGCGCTCG
AGGTCCCCCGCACCTGAGTTCGGTAGCAGACAGGCTTCCATGGCACGCCTCGCATCCCCAGTGCCCTCTCCTTCA
TTAGGAACGTCCTTGTCATCACGACAGGGTATTCCGGCCAGCCGACCTGTTACAAACACCACCACCGAGCAGGAG
TTTTCCAGATCGATTGCCAATCCATCCTCGATCCCCGGTCCTGGACATTCTATCCTTGCATCCCAACTCCAAGAA
AGCCTCGGTCGTTCGCCGCCGAGATTTGGAACTCCGTCACGACACAACGGATCCCCTGCGGTGCATTCGACGTTA
GATAACCGACCGTTGGCCTCTCAGTATGGCTCTTTCGATACTAAAAACGGAGTCGACTCGTCGAGCATAGCTCCG
GTAGAAGACCCTGAAGTTATCAAGCGGCATCTGGTCACGGAACACACAGATAATCAGTCGGAAATTGCGACCAGC
CTTGGTGGCGAAGATACTTTCTCGAGTCTGCAGCTTCAAGGTGGTGATATTACACGACAAGTTTACCGTTGGGCG
GAGGATGCCGAAGCTGAAGCCGCAGGGCGATTCTTGCGCAGCAAGAGTTTCAGCGTCAGTCGACCAAGGCCGGAG
ACGGATACGGAAGACATTGACACAATTCGGGTACCAGGAGGGTTTCGCAGGGATTACCTACGAAGAGCAGCTGGA
AGTCCACACCGCGGAGATGCCCACGGGTCAAACGTAGGGCCGCCCCATGGACACGGCGCACCTCAACTGCCGACT
ACCAGCTTCTTGGAGTTCTTGACTCTCTATGGACACTTTGCCGGAGAAGAATTGGAGGAAGATGATGAGGTACTA
GGGCCGGATGAGTACTTTTCGTCTGATGCCTGGGACGAGCCAGATGATGGCAGAGAGTCTGGAGAAGACGCAGCG
CTGTTGCCGCCTGAAACACCGGGTCGGAAGAAGAGAAAGCACAAGCAACGCTCACCGGTAGGGACAACTACCACA
ACAGGTGCAGTACTCTTGCTGCTCAAATCCTTTGTAGGTACCGGTATTTTGTTCCTACCTCGAGCCTTCCTGAAT
GGTGGTATGCTCTTTAGTAGCATGGTGCTTCTGGGAGTCTCGATTCTCAGCTATTATGCTTTCATTCTTTTGGTC
AATACTCGCACGAAGATCGAAGGGTCCTTCGGTGACATCGGTGGCATTCTATACGGCAAGCACATGCGACGCATC
ATTCTCGGATCAATTGTCCTGAGTCAATTAGGCTTTGTGGCAGCGTACATTGTCTTCGTCTCGCAAAATTTGCAG
GCATTCGTGCTAGCTGTGAGCAGGTGCGCAACGTTCATTGACATCAAGTACATGGTTTTGTTGCAGCTGGTCATC
TTCCTGCCCCTGTCTTTGATTCGGGACATCAGCAAACTTGGGTTTACCGCCCTGATTGCTGATGTCTTCATTCTG
TTGGGTCTCCTATATATCTACTACTACGATATCAGCACTCTGGTTGACCAGGGCGGCATCTCAGATATCGTTTCC
TTCAATCCAACAACCTGGTCCATGTTCATCGGTACCGCCATCTTCACCTACGAAGGTATCGGTCTCATCATTCCG
ATTCAAGAATCAATGAAGCAGCCAAACAGGTTCCCTGGTGTCCTGGCCGGCGTCATGGTTCTCATTACCTTTATC
TTCCTCTCTGCCGGTGCCCTGAGCTACGCGGCGTATGGATCGGCAACGAAAACCGTCATCCTTCTTAACCTCCCC
CAGGATGACAAATTTGTCAACGTGGTCCAGTTCCTCTATTCACTTGCCATTCTGCTGAGCACTCCGTTGCAGCTC
TTCCCTGCTATCCGCATTATGGAGAACGAGCTTTTCACCCGCAGTGGCAAGTACAACCCATATATCAAGTGGAAG
AAGAACGGCTTCCGTTTCTTCCTGGTTATGGTCTGTGCCCTTATCGCCTGGTGTGGTGCGAATGATCTAGACAAG
TTCGTTTCGCTAGTCGGAAGCTTTGCTTGTGTTCCATTGATCTACGTATACCCGCCCCTCCTGCACCTACGCGCT
TGTGCTGCCTCCAAGCGCCAGGCGGTTGCCGACGTAACTCTTGCTGTCTTCGGCGCCATATGCTGCGTCTATACG
ACGTACCTGACCCTCATGAGCTGGATGGGCCCTGACGTCCCTCAAAGCCCGGGATACTGTGACTCTCTTTGA
Transcript >Pro_DTO377G3_2|g8300.t1
ATGGCGGATAATGGCGAGGGTCCATCCCTAAATCCAGCTCGATCTGTGCCGATAGCCTCGTCCTCCGCGCGCTCG
AGGTCCCCCGCACCTGAGTTCGGTAGCAGACAGGCTTCCATGGCACGCCTCGCATCCCCAGTGCCCTCTCCTTCA
TTAGGAACGTCCTTGTCATCACGACAGGGTATTCCGGCCAGCCGACCTGTTACAAACACCACCACCGAGCAGGAG
TTTTCCAGATCGATTGCCAATCCATCCTCGATCCCCGGTCCTGGACATTCTATCCTTGCATCCCAACTCCAAGAA
AGCCTCGGTCGTTCGCCGCCGAGATTTGGAACTCCGTCACGACACAACGGATCCCCTGCGGTGCATTCGACGTTA
GATAACCGACCGTTGGCCTCTCAGTATGGCTCTTTCGATACTAAAAACGGAGTCGACTCGTCGAGCATAGCTCCG
GTAGAAGACCCTGAAGTTATCAAGCGGCATCTGGTCACGGAACACACAGATAATCAGTCGGAAATTGCGACCAGC
CTTGGTGGCGAAGATACTTTCTCGAGTCTGCAGCTTCAAGGTGGTGATATTACACGACAAGTTTACCGTTGGGCG
GAGGATGCCGAAGCTGAAGCCGCAGGGCGATTCTTGCGCAGCAAGAGTTTCAGCGTCAGTCGACCAAGGCCGGAG
ACGGATACGGAAGACATTGACACAATTCGGGTACCAGGAGGGTTTCGCAGGGATTACCTACGAAGAGCAGCTGGA
AGTCCACACCGCGGAGATGCCCACGGGTCAAACGTAGGGCCGCCCCATGGACACGGCGCACCTCAACTGCCGACT
ACCAGCTTCTTGGAGTTCTTGACTCTCTATGGACACTTTGCCGGAGAAGAATTGGAGGAAGATGATGAGGTACTA
GGGCCGGATGAGTACTTTTCGTCTGATGCCTGGGACGAGCCAGATGATGGCAGAGAGTCTGGAGAAGACGCAGCG
CTGTTGCCGCCTGAAACACCGGGTCGGAAGAAGAGAAAGCACAAGCAACGCTCACCGGTAGGGACAACTACCACA
ACAGGTGCAGTACTCTTGCTGCTCAAATCCTTTGTAGGTACCGGTATTTTGTTCCTACCTCGAGCCTTCCTGAAT
GGTGGTATGCTCTTTAGTAGCATGGTGCTTCTGGGAGTCTCGATTCTCAGCTATTATGCTTTCATTCTTTTGGTC
AATACTCGCACGAAGATCGAAGGGTCCTTCGGTGACATCGGTGGCATTCTATACGGCAAGCACATGCGACGCATC
ATTCTCGGATCAATTGTCCTGAGTCAATTAGGCTTTGTGGCAGCGTACATTGTCTTCGTCTCGCAAAATTTGCAG
GCATTCGTGCTAGCTGTGAGCAGGTGCGCAACGTTCATTGACATCAAGTACATGGTTTTGTTGCAGCTGGTCATC
TTCCTGCCCCTGTCTTTGATTCGGGACATCAGCAAACTTGGGTTTACCGCCCTGATTGCTGATGTCTTCATTCTG
TTGGGTCTCCTATATATCTACTACTACGATATCAGCACTCTGGTTGACCAGGGCGGCATCTCAGATATCGTTTCC
TTCAATCCAACAACCTGGTCCATGTTCATCGGTACCGCCATCTTCACCTACGAAGGTATCGGTCTCATCATTCCG
ATTCAAGAATCAATGAAGCAGCCAAACAGGTTCCCTGGTGTCCTGGCCGGCGTCATGGTTCTCATTACCTTTATC
TTCCTCTCTGCCGGTGCCCTGAGCTACGCGGCGTATGGATCGGCAACGAAAACCGTCATCCTTCTTAACCTCCCC
CAGGATGACAAATTTGTCAACGTGGTCCAGTTCCTCTATTCACTTGCCATTCTGCTGAGCACTCCGTTGCAGCTC
TTCCCTGCTATCCGCATTATGGAGAACGAGCTTTTCACCCGCAGTGGCAAGTACAACCCATATATCAAGTGGAAG
AAGAACGGCTTCCGTTTCTTCCTGGTTATGGTCTGTGCCCTTATCGCCTGGTGTGGTGCGAATGATCTAGACAAG
TTCGTTTCGCTAGTCGGAAGCTTTGCTTGTGTTCCATTGATCTACGTATACCCGCCCCTCCTGCACCTACGCGCT
TGTGCTGCCTCCAAGCGCCAGGCGGTTGCCGACGTAACTCTTGCTGTCTTCGGCGCCATATGCTGCGTCTATACG
ACGTACCTGACCCTCATGAGCTGGATGGGCCCTGACGTCCCTCAAAGCCCGGGATACTGTGACTCTCTTTGA
Gene >Pro_DTO377G3_2|g8300.t1
ATGGCGGATAATGGCGAGGGTCCATCCCTAAATCCAGCTCGATCTGTGCCGATAGCCTCGTCCTCCGCGCGCTCG
AGGTCCCCCGCACCTGAGTTCGGTAGCAGACAGGCTTCCATGGCACGCCTCGCATCCCCAGTGCCCTCTCCTTCA
TTAGGAACGTCCTTGTCATCACGACAGGGTATTCCGGCCAGCCGACCTGTTACAAACACCACCACCGAGCAGGAG
TTTTCCAGATCGATTGCCAATCCATCCTCGATCCCCGGTCCTGGACATTCTATCCTTGCATCCCAACTCCAAGAA
AGCCTCGGTCGTTCGCCGCCGAGATTTGGAACTCCGTCACGACACAACGGATCCCCTGCGGTGCATTCGACGTTA
GATAACCGACCGTTGGCCTCTCAGTATGGCTCTTTCGATACTAAAAACGGAGTCGACTCGTCGAGCATAGCTCCG
GTAGAAGACCCTGAAGTTATCAAGCGGCATCTGGTCACGGAACACACAGATAATCAGTCGGAAATTGCGACCAGC
CTTGGTGGCGAAGATACTTTCTCGAGTCTGCAGCTTCAAGGTGGTGATATTACACGACAAGTTTACCGTTGGGCG
GAGGATGCCGAAGCTGAAGCCGCAGGGCGATTCTTGCGCAGCAAGAGTTTCAGCGTCAGTCGACCAAGGCCGGAG
ACGGATACGGAAGACATTGACACAATTCGGGTACCAGGAGGGTTTCGCAGGGATTACCTACGAAGAGCAGCTGGA
AGTCCACACCGCGGAGATGCCCACGGGTCAAACGTAGGGCCGCCCCATGGACACGGCGCACCTCAACTGCCGACT
ACCAGCTTCTTGGAGTTCTTGACTCTCTATGGACACTTTGCCGGAGAAGAATTGGAGGAAGATGATGAGGTACTA
GGGCCGGATGAGTACTTTTCGTCTGATGCCTGGGACGAGCCAGATGATGGCAGAGAGTCTGGAGAAGACGCAGCG
CTGTTGCCGCCTGAAACACCGGGTCGGAAGAAGAGAAAGCACAAGCAACGCTCACCGGTAGGGACAACTACCACA
ACAGGTGCAGTACTCTTGCTGCTCAAATCCTTTGTAGGTACCGGTATTTTGTTCCTACCTCGAGCCTTCCTGAAT
GGTGGTATGCTCTTTAGTAGCATGGTGCTTCTGGGAGTCTCGATTCTCAGCTATTATGCTTTCATTCTTTTGGTC
AATACTCGCACGAAGATCGAAGGGTCCTTCGGTGACATCGGTGGCATTCTATACGGCAAGCACATGCGACGCATC
ATTCTCGGATCAATTGTCCTGAGTCAATTAGGCTTTGTGGCAGCGTACATTGTCTTCGTCTCGCAAAATTTGCAG
GCATTCGTGCTAGCTGTGAGCAGGTGCGCAACGTTCATTGACATCAAGTACATGGTTTTGTTGCAGCTGGTCATC
TTCCTGCCCCTGTCTTTGATTCGGGACATCAGCAAACTTGGGTTTACCGCCCTGATTGCTGATGTCTTCATTCTG
TTGGGTCTCCTATATATCTACTACTACGATATCAGCACTCTGGTTGACCAGGGCGGCATCTCAGATATCGTTTCC
TTCAATCCAACAACCTGGTCCATGTTCATCGGTACCGCCATCTTCACCTACGAAGGTATCGGTCTCATCATTCCG
ATTCAAGAATCAATGAAGCAGCCAAACAGGTTCCCTGGTGTCCTGGCCGGCGTCATGGTTCTCATTACCTTTATC
TTCCTCTCTGCCGGTGCCCTGAGCTACGCGGCGTATGGATCGGCAACGAAAACCGTCATCCTTCTTAACCTCCCC
CAGGATGACAAATTTGTCAACGTGGTCCAGTTCCTCTATTCACTTGCCATTCTGCTGAGCACTCCGTTGCAGCTC
TTCCCTGCTATCCGCATTATGGAGAACGAGCTTTTCACCCGCAGTGGCAAGTACAACCCATATATCAAGTGGAAG
AAGAACGGCTTCCGTTTCTTCCTGGTTATGGTCTGTGCCCTTATCGCCTGGTGTGGTGCGAATGATCTAGACAAG
TTCGTTTCGCTAGTCGGAAGCTTTGCTTGTGTTCCATTGATCTACGTATACCCGGTATGTCTTATCATGTGTCCT
CCTAATCACCACAGAACTGTATGACTGACTCAGTATATCGCTGTAGCCCCTCCTGCACCTACGCGCTTGTGCTGC
CTCCAAGCGCCAGGCGGTTGCCGACGTAACTCTTGCTGTCTTCGGCGCCATATGCTGCGTCTATACGACGTACCT
GACCCTCATGAGCTGGATGGGCCCTGACGTCCCTCAAAGCCCGGGATACTGTGACTCTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail