Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g829.t1
Gene name
Locationscaffold_01:2214562..2215543
Strand-
Gene length (bp)981
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.0E-10 39 270

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.77 0.83 6.72
5d_25C Five days - 25 degrees Celsius 3.53 0.74 6.31
7d_25C Seven days - 25 degrees Celsius 4.44 0.94 7.94
10d_25C Ten days - 25 degrees Celsius 4.29 0.89 7.70
7d_15C Seven days - 15 degrees Celsius 2.57 0.33 4.80
7d_30C Seven days - 30 degrees Celsius 2.94 0.43 5.44

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.922394 no
3d_25C 7d_25C 0.796006 no
3d_25C 7d_15C 0.482882 no
3d_25C 7d_30C 0.677244 no
3d_25C 10d_25C 0.844954 no
5d_25C 7d_25C 0.690688 no
5d_25C 7d_15C 0.579109 no
5d_25C 7d_30C 0.776093 no
5d_25C 10d_25C 0.742013 no
7d_25C 7d_15C 0.278993 no
7d_25C 7d_30C 0.441107 no
7d_25C 10d_25C 0.962173 no
7d_15C 7d_30C 0.854349 no
7d_15C 10d_25C 0.311439 no
7d_30C 10d_25C 0.485946 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g829.t1
MATKSSDKIFPITTFISDLPTNLILQPLPSSENGSVSGRLIIVGDVHGMEKSLEALLDKVDFDKHKGDHLILVGD
LVNKGPDSPGVVDLAMKLGASAVRGNHENAVLIAAAEIKVNATRDTLLHSRGVADDPVVPENPDAELPGNNIRDC
EIADKCVPATSHSTASVLSTRHLDWLATLPLILRVKLPHVLTSCFGDILIVVHAGLVPGIPLEDQDPHAVMHMRS
LIRKSGDEDVFVPAEIPGEESWVMEWNRCQDRLASKTMVIFGHDAKRQLQLSRYAIGLDSACLYGHQLSAVVIGA
SDGRFEHHVVQVECADVPIIPTVSVK*
Coding >Pro_DTO377G3_2|g829.t1
ATGGCCACAAAATCTTCCGACAAGATATTCCCAATCACAACCTTTATTTCAGACCTGCCGACCAACCTTATTCTG
CAACCTCTCCCATCATCTGAAAATGGTTCTGTCAGTGGACGTTTGATCATTGTAGGCGATGTGCACGGGATGGAA
AAGTCCCTTGAGGCACTCTTAGACAAGGTCGATTTCGACAAACACAAGGGAGATCATCTGATACTAGTTGGCGAC
CTCGTCAATAAAGGCCCCGATAGTCCTGGTGTTGTTGATCTGGCCATGAAGCTTGGCGCTAGCGCCGTGAGAGGC
AACCACGAAAATGCAGTTCTTATTGCGGCTGCGGAGATCAAGGTCAACGCCACAAGGGATACGCTACTGCACTCT
AGGGGCGTGGCTGACGATCCGGTCGTACCTGAAAATCCCGACGCGGAGCTACCCGGAAATAATATCCGAGATTGT
GAGATCGCCGACAAATGCGTACCTGCCACATCGCACAGTACGGCCTCGGTACTTTCGACGCGTCATCTCGACTGG
CTTGCCACTTTGCCATTGATATTGCGCGTCAAGCTACCTCATGTCCTAACATCCTGCTTCGGTGACATTCTAATT
GTCGTACATGCTGGCCTCGTTCCTGGCATCCCACTTGAAGACCAGGATCCACACGCTGTAATGCATATGCGGAGC
CTTATCCGTAAATCAGGTGACGAGGATGTATTCGTACCGGCTGAAATTCCCGGAGAAGAAAGCTGGGTTATGGAA
TGGAACCGGTGCCAAGATAGGCTAGCATCCAAGACTATGGTGATATTCGGGCATGATGCAAAGCGCCAGTTGCAG
CTAAGCAGGTATGCAATTGGACTGGACTCGGCGTGTTTATACGGCCATCAATTAAGTGCGGTTGTAATTGGGGCT
TCTGACGGGAGATTTGAGCATCATGTTGTTCAAGTCGAATGTGCTGATGTGCCTATCATTCCAACAGTCTCTGTG
AAGTAA
Transcript >Pro_DTO377G3_2|g829.t1
ATGGCCACAAAATCTTCCGACAAGATATTCCCAATCACAACCTTTATTTCAGACCTGCCGACCAACCTTATTCTG
CAACCTCTCCCATCATCTGAAAATGGTTCTGTCAGTGGACGTTTGATCATTGTAGGCGATGTGCACGGGATGGAA
AAGTCCCTTGAGGCACTCTTAGACAAGGTCGATTTCGACAAACACAAGGGAGATCATCTGATACTAGTTGGCGAC
CTCGTCAATAAAGGCCCCGATAGTCCTGGTGTTGTTGATCTGGCCATGAAGCTTGGCGCTAGCGCCGTGAGAGGC
AACCACGAAAATGCAGTTCTTATTGCGGCTGCGGAGATCAAGGTCAACGCCACAAGGGATACGCTACTGCACTCT
AGGGGCGTGGCTGACGATCCGGTCGTACCTGAAAATCCCGACGCGGAGCTACCCGGAAATAATATCCGAGATTGT
GAGATCGCCGACAAATGCGTACCTGCCACATCGCACAGTACGGCCTCGGTACTTTCGACGCGTCATCTCGACTGG
CTTGCCACTTTGCCATTGATATTGCGCGTCAAGCTACCTCATGTCCTAACATCCTGCTTCGGTGACATTCTAATT
GTCGTACATGCTGGCCTCGTTCCTGGCATCCCACTTGAAGACCAGGATCCACACGCTGTAATGCATATGCGGAGC
CTTATCCGTAAATCAGGTGACGAGGATGTATTCGTACCGGCTGAAATTCCCGGAGAAGAAAGCTGGGTTATGGAA
TGGAACCGGTGCCAAGATAGGCTAGCATCCAAGACTATGGTGATATTCGGGCATGATGCAAAGCGCCAGTTGCAG
CTAAGCAGGTATGCAATTGGACTGGACTCGGCGTGTTTATACGGCCATCAATTAAGTGCGGTTGTAATTGGGGCT
TCTGACGGGAGATTTGAGCATCATGTTGTTCAAGTCGAATGTGCTGATGTGCCTATCATTCCAACAGTCTCTGTG
AAGTAA
Gene >Pro_DTO377G3_2|g829.t1
ATGGCCACAAAATCTTCCGACAAGATATTCCCAATCACAACCTTTATTTCAGACCTGCCGACCAACCTTATTCTG
CAACCTCTCCCATCATCTGAAAATGGTTCTGTCAGTGGACGTTTGATCATTGTAGGCGATGTGCACGGGATGGAA
AAGTCCCTTGAGGCACTCTTAGACAAGGTCGATTTCGACAAACACAAGGGAGATCATCTGATACTAGTTGGCGAC
CTCGTCAATAAAGGCCCCGATAGTCCTGGTGTTGTTGATCTGGCCATGAAGCTTGGCGCTAGCGCCGTGAGAGGC
AACCACGAAAATGCAGTTCTTATTGCGGCTGCGGAGATCAAGGTCAACGCCACAAGGGATACGCTACTGCACTCT
AGGGGCGTGGCTGACGATCCGGTCGTACCTGAAAATCCCGACGCGGAGCTACCCGGAAATAATATCCGAGATTGT
GAGATCGCCGACAAATGCGTACCTGCCACATCGCACAGTACGGCCTCGGTACTTTCGACGCGTCATCTCGACTGG
CTTGCCACTTTGCCATTGATATTGCGCGTCAAGCTACCTCATGTCCTAACATCCTGCTTCGGTGACATTCTAATT
GTCGTACATGCTGGCCTCGTTCCTGGCATCCCACTTGAAGACCAGGATCCACACGCTGTAATGCATATGCGGAGC
CTTATCCGTAAATCAGGTGACGAGGATGTATTCGTACCGGCTGAAATTCCCGGAGAAGAAAGCTGGGTTATGGAA
TGGAACCGGTGCCAAGATAGGCTAGCATCCAAGACTATGGTGATATTCGGGCATGATGCAAAGCGCCAGTTGCAG
CTAAGCAGGTATGCAATTGGACTGGACTCGGCGTGTTTATACGGCCATCAATTAAGTGCGGTTGTAATTGGGGCT
TCTGACGGGAGATTTGAGCATCATGTTGTTCAAGTCGAATGTGCTGATGTGCCTATCATTCCAACAGTCTCTGTG
AAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail