Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8286.t1
Gene name
Locationscaffold_31:89476..90763
Strand+
Gene length (bp)1287
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00291 PALP Pyridoxal-phosphate dependent enzyme 1.4E-47 19 331

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 5.24 1.62 8.86
5d_25C Five days - 25 degrees Celsius 2.96 0.61 5.32
7d_25C Seven days - 25 degrees Celsius 3.24 0.70 5.79
10d_25C Ten days - 25 degrees Celsius 1.86 0.21 3.51
7d_15C Seven days - 15 degrees Celsius 5.77 1.74 9.81
7d_30C Seven days - 30 degrees Celsius 17.77 7.91 27.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.179756 no
3d_25C 7d_25C 0.278913 no
3d_25C 7d_15C 0.859892 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.016098 yes
5d_25C 7d_25C 0.890027 no
5d_25C 7d_15C 0.106471 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.366472 no
7d_25C 7d_15C 0.167666 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.258157 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.009770 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8286.t1
MGSIDISAYGQLQFKTPWIETPLVESACLSRAAGCRIFLKLENVQPSGSFKSRAMGNQILSHLRNPENVGRRVHF
YASSGGNAGLAAVCAARSLGYPCTVVVPMGTNPLMLDKIRAAGAADVIRHGETFSEAGEYMRETIMKTSSGNDQD
VIKIALHPFDNQPIWEGNGTIIDELETQLPPATTPEDKKAYNDRALPLDAILCSVGGGGLLNGLVMGIEKRRQKK
QITSYSSPTPNPIHLLAIETAGTDSLAAAIANKSLISLPRITSQATSLGAVRVSETTFQYAVSPPPGIKVHSAVL
SDADAARGVLRLANDERLLVELACGVCIEAAIGDAATAVPTSKWKRGLDETDITYRDEGYGDDRSTSTDNETDQE
VEPEVGEKLNSKLKQLVPDLNSQSRIVIIVCGGSNVTIDMASEWRKMLDEGWA*
Coding >Pro_DTO377G3_2|g8286.t1
ATGGGGAGCATCGACATTTCCGCCTATGGTCAGCTGCAGTTCAAGACGCCATGGATTGAGACACCACTGGTCGAG
TCTGCATGCCTTTCTCGAGCAGCTGGTTGTAGGATCTTCTTAAAGTTAGAGAACGTGCAGCCAAGTGGCTCCTTC
AAGTCCCGTGCTATGGGCAACCAAATCCTTTCTCACCTTCGCAACCCAGAGAACGTGGGCCGCAGAGTCCATTTC
TACGCCTCGTCCGGAGGAAACGCCGGACTGGCAGCCGTCTGTGCAGCCCGGAGCCTGGGCTACCCATGCACTGTC
GTGGTTCCCATGGGCACAAATCCCTTGATGCTTGACAAGATCCGGGCGGCAGGTGCAGCAGACGTCATCCGGCAT
GGCGAGACATTTTCAGAAGCAGGAGAATACATGCGGGAAACTATCATGAAGACAAGCAGCGGGAATGACCAGGAT
GTGATCAAAATCGCCCTCCACCCCTTCGACAACCAGCCTATCTGGGAAGGAAACGGCACCATCATCGACGAGCTC
GAGACCCAGCTTCCTCCCGCCACCACCCCCGAAGACAAAAAAGCCTACAATGACCGGGCCCTCCCTTTAGACGCC
ATCCTCTGCAGCGTCGGCGGTGGCGGCCTTCTCAATGGACTCGTCATGGGCATCGAAAAGCGACGACAGAAGAAG
CAAATTACCTCATATTCCTCACCCACACCAAACCCCATTCATCTCCTCGCCATTGAAACGGCCGGCACCGATTCA
CTGGCAGCAGCCATCGCCAATAAATCCCTCATCTCCCTCCCAAGGATCACATCCCAGGCCACTTCTCTCGGTGCT
GTCCGCGTCTCGGAAACAACTTTCCAGTACGCCGTGTCCCCGCCCCCAGGCATCAAGGTGCACAGCGCCGTGCTC
TCAGATGCAGACGCCGCCCGCGGCGTGCTCCGCCTCGCCAACGATGAACGACTCCTCGTCGAGCTTGCGTGCGGT
GTCTGTATCGAAGCGGCCATCGGCGATGCTGCTACTGCTGTTCCTACATCGAAGTGGAAGAGGGGCTTGGATGAG
ACTGATATTACTTACCGCGATGAGGGCTATGGGGATGACCGGTCGACCTCGACGGACAATGAGACAGACCAGGAG
GTTGAGCCAGAAGTCGGCGAGAAACTGAATTCGAAGCTTAAGCAACTTGTTCCTGATCTCAACTCGCAGAGTAGA
ATTGTCATCATTGTCTGCGGCGGTAGCAACGTCACTATCGATATGGCTAGTGAATGGCGCAAGATGTTGGATGAG
GGATGGGCTTGA
Transcript >Pro_DTO377G3_2|g8286.t1
ATGGGGAGCATCGACATTTCCGCCTATGGTCAGCTGCAGTTCAAGACGCCATGGATTGAGACACCACTGGTCGAG
TCTGCATGCCTTTCTCGAGCAGCTGGTTGTAGGATCTTCTTAAAGTTAGAGAACGTGCAGCCAAGTGGCTCCTTC
AAGTCCCGTGCTATGGGCAACCAAATCCTTTCTCACCTTCGCAACCCAGAGAACGTGGGCCGCAGAGTCCATTTC
TACGCCTCGTCCGGAGGAAACGCCGGACTGGCAGCCGTCTGTGCAGCCCGGAGCCTGGGCTACCCATGCACTGTC
GTGGTTCCCATGGGCACAAATCCCTTGATGCTTGACAAGATCCGGGCGGCAGGTGCAGCAGACGTCATCCGGCAT
GGCGAGACATTTTCAGAAGCAGGAGAATACATGCGGGAAACTATCATGAAGACAAGCAGCGGGAATGACCAGGAT
GTGATCAAAATCGCCCTCCACCCCTTCGACAACCAGCCTATCTGGGAAGGAAACGGCACCATCATCGACGAGCTC
GAGACCCAGCTTCCTCCCGCCACCACCCCCGAAGACAAAAAAGCCTACAATGACCGGGCCCTCCCTTTAGACGCC
ATCCTCTGCAGCGTCGGCGGTGGCGGCCTTCTCAATGGACTCGTCATGGGCATCGAAAAGCGACGACAGAAGAAG
CAAATTACCTCATATTCCTCACCCACACCAAACCCCATTCATCTCCTCGCCATTGAAACGGCCGGCACCGATTCA
CTGGCAGCAGCCATCGCCAATAAATCCCTCATCTCCCTCCCAAGGATCACATCCCAGGCCACTTCTCTCGGTGCT
GTCCGCGTCTCGGAAACAACTTTCCAGTACGCCGTGTCCCCGCCCCCAGGCATCAAGGTGCACAGCGCCGTGCTC
TCAGATGCAGACGCCGCCCGCGGCGTGCTCCGCCTCGCCAACGATGAACGACTCCTCGTCGAGCTTGCGTGCGGT
GTCTGTATCGAAGCGGCCATCGGCGATGCTGCTACTGCTGTTCCTACATCGAAGTGGAAGAGGGGCTTGGATGAG
ACTGATATTACTTACCGCGATGAGGGCTATGGGGATGACCGGTCGACCTCGACGGACAATGAGACAGACCAGGAG
GTTGAGCCAGAAGTCGGCGAGAAACTGAATTCGAAGCTTAAGCAACTTGTTCCTGATCTCAACTCGCAGAGTAGA
ATTGTCATCATTGTCTGCGGCGGTAGCAACGTCACTATCGATATGGCTAGTGAATGGCGCAAGATGTTGGATGAG
GGATGGGCTTGA
Gene >Pro_DTO377G3_2|g8286.t1
ATGGGGAGCATCGACATTTCCGCCTATGGTCAGCTGCAGTTCAAGACGCCATGGATTGAGACACCACTGGTCGAG
TCTGCATGCCTTTCTCGAGCAGCTGGTTGTAGGATCTTCTTAAAGTTAGAGAACGTGCAGCCAAGTGGCTCCTTC
AAGTCCCGTGCTATGGGCAACCAAATCCTTTCTCACCTTCGCAACCCAGAGAACGTGGGCCGCAGAGTCCATTTC
TACGCCTCGTCCGGAGGAAACGCCGGACTGGCAGCCGTCTGTGCAGCCCGGAGCCTGGGCTACCCATGCACTGTC
GTGGTTCCCATGGGCACAAATCCCTTGATGCTTGACAAGATCCGGGCGGCAGGTGCAGCAGACGTCATCCGGCAT
GGCGAGACATTTTCAGAAGCAGGAGAATACATGCGGGAAACTATCATGAAGACAAGCAGCGGGAATGACCAGGAT
GTGATCAAAATCGCCCTCCACCCCTTCGACAACCAGCCTATCTGGGAAGGAAACGGCACCATCATCGACGAGCTC
GAGACCCAGCTTCCTCCCGCCACCACCCCCGAAGACAAAAAAGCCTACAATGACCGGGCCCTCCCTTTAGACGCC
ATCCTCTGCAGCGTCGGCGGTGGCGGCCTTCTCAATGGACTCGTCATGGGCATCGAAAAGCGACGACAGAAGAAG
CAAATTACCTCATATTCCTCACCCACACCAAACCCCATTCATCTCCTCGCCATTGAAACGGCCGGCACCGATTCA
CTGGCAGCAGCCATCGCCAATAAATCCCTCATCTCCCTCCCAAGGATCACATCCCAGGCCACTTCTCTCGGTGCT
GTCCGCGTCTCGGAAACAACTTTCCAGTACGCCGTGTCCCCGCCCCCAGGCATCAAGGTGCACAGCGCCGTGCTC
TCAGATGCAGACGCCGCCCGCGGCGTGCTCCGCCTCGCCAACGATGAACGACTCCTCGTCGAGCTTGCGTGCGGT
GTCTGTATCGAAGCGGCCATCGGCGATGCTGCTACTGCTGTTCCTACATCGAAGTGGAAGAGGGGCTTGGATGAG
ACTGATATTACTTACCGCGATGAGGGCTATGGGGATGACCGGTCGACCTCGACGGACAATGAGACAGACCAGGAG
GTTGAGCCAGAAGTCGGCGAGAAACTGAATTCGAAGCTTAAGCAACTTGTTCCTGATCTCAACTCGCAGAGTAGA
ATTGTCATCATTGTCTGCGGCGGTAGCAACGTCACTATCGATATGGCTAGTGAATGGCGCAAGATGTTGGATGAG
GGATGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail