Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8271.t1
Gene name
Locationscaffold_31:62081..63217
Strand-
Gene length (bp)1136
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 1.9E-49 140 326

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 11.51 4.53 18.49
5d_25C Five days - 25 degrees Celsius 11.04 4.37 17.72
7d_25C Seven days - 25 degrees Celsius 9.46 3.48 15.44
10d_25C Ten days - 25 degrees Celsius 8.70 3.16 14.24
7d_15C Seven days - 15 degrees Celsius 26.46 13.25 39.68
7d_30C Seven days - 30 degrees Celsius 8.08 2.83 13.32

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.937463 no
3d_25C 7d_25C 0.656034 no
3d_25C 7d_15C 0.005626 yes
3d_25C 7d_30C 0.357951 no
3d_25C 10d_25C 0.494687 no
5d_25C 7d_25C 0.740991 no
5d_25C 7d_15C 0.001278 yes
5d_25C 7d_30C 0.427070 no
5d_25C 10d_25C 0.572535 no
7d_25C 7d_15C 0.001278 yes
7d_25C 7d_30C 0.737755 no
7d_25C 10d_25C 0.873722 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.889315 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8271.t1
MVYYVRFLKTPRIQQQKGAIYISALICITTDLGDSFLAEDVDLMVIAENSSRVIFQKTTKWNASNRELAITLGPL
PSNLAQQSMVLTVKMPDSPEYVIPQYSPIQLVVAATSAPFGPHSTPAEKLVQRRLQYSGCEPFPMEIWEETGNSI
ARHIWDAGLATVTYLHLMCEDIRKTARNKNKGPEPKIQALKQVLSVCNRPIQVVELGAGCGIAGIALASMLPNCS
VLLTDLPEVEEIITRNMNVAQLATMSSLHYQNLDWDDPPDELCPRPIDLILVSDCTYNSDSLPALVSTLDRLVRT
SPEAIVLVALKRRHDSETVFFDLMRSARFTAVQDSVEIPSQHDEVDEIEFYCYSRLI*
Coding >Pro_DTO377G3_2|g8271.t1
ATGGTCTACTATGTTAGATTCCTGAAAACCCCCAGAATCCAACAACAGAAAGGGGCCATCTACATCTCCGCTCTT
ATCTGCATCACCACTGATCTAGGGGACTCTTTTCTTGCTGAAGATGTTGATTTGATGGTGATAGCTGAGAATTCC
TCTCGAGTTATATTTCAGAAAACGACAAAATGGAATGCCAGTAATCGAGAACTTGCTATTACCCTGGGTCCTCTC
CCATCCAATCTGGCCCAGCAGTCTATGGTGTTGACGGTTAAAATGCCGGACTCACCAGAATATGTCATACCCCAG
TATTCCCCCATACAATTAGTGGTTGCTGCAACAAGTGCTCCATTTGGGCCTCATTCCACACCAGCAGAGAAGCTG
GTTCAACGCCGCCTTCAATACAGCGGCTGTGAACCATTCCCCATGGAAATATGGGAAGAGACAGGAAATAGCATT
GCTCGACACATATGGGATGCGGGCCTAGCAACAGTTACATACCTTCACCTGATGTGTGAGGATATAAGGAAGACG
GCCCGTAACAAGAACAAAGGCCCTGAACCTAAAATACAAGCTTTGAAGCAGGTCCTATCCGTCTGCAACCGACCT
ATCCAGGTAGTTGAGCTTGGGGCAGGATGTGGGATAGCGGGAATTGCATTGGCATCAATGCTCCCGAATTGTTCG
GTATTACTCACAGATCTCCCTGAGGTTGAGGAGATAATAACACGCAATATGAATGTTGCCCAACTCGCAACCATG
TCCAGTCTTCACTATCAAAATCTCGACTGGGACGACCCACCGGATGAGCTCTGCCCACGGCCTATTGACCTCATT
CTTGTCTCTGATTGTACCTACAATTCAGATAGCTTGCCCGCGCTAGTCTCTACGCTTGACCGATTGGTTCGGACC
TCCCCAGAGGCAATCGTCTTGGTGGCTCTGAAGAGACGACATGACAGCGAAACGGTGTTTTTCGACTTGATGCGC
TCGGCGAGATTTACGGCGGTGCAGGACAGCGTTGAAATCCCTTCGCAGCACGATGAGGTGGATGAAATTGAGTTT
TACTGCTACAGTCGATTAATTTAG
Transcript >Pro_DTO377G3_2|g8271.t1
ATGGTCTACTATGTTAGATTCCTGAAAACCCCCAGAATCCAACAACAGAAAGGGGCCATCTACATCTCCGCTCTT
ATCTGCATCACCACTGATCTAGGGGACTCTTTTCTTGCTGAAGATGTTGATTTGATGGTGATAGCTGAGAATTCC
TCTCGAGTTATATTTCAGAAAACGACAAAATGGAATGCCAGTAATCGAGAACTTGCTATTACCCTGGGTCCTCTC
CCATCCAATCTGGCCCAGCAGTCTATGGTGTTGACGGTTAAAATGCCGGACTCACCAGAATATGTCATACCCCAG
TATTCCCCCATACAATTAGTGGTTGCTGCAACAAGTGCTCCATTTGGGCCTCATTCCACACCAGCAGAGAAGCTG
GTTCAACGCCGCCTTCAATACAGCGGCTGTGAACCATTCCCCATGGAAATATGGGAAGAGACAGGAAATAGCATT
GCTCGACACATATGGGATGCGGGCCTAGCAACAGTTACATACCTTCACCTGATGTGTGAGGATATAAGGAAGACG
GCCCGTAACAAGAACAAAGGCCCTGAACCTAAAATACAAGCTTTGAAGCAGGTCCTATCCGTCTGCAACCGACCT
ATCCAGGTAGTTGAGCTTGGGGCAGGATGTGGGATAGCGGGAATTGCATTGGCATCAATGCTCCCGAATTGTTCG
GTATTACTCACAGATCTCCCTGAGGTTGAGGAGATAATAACACGCAATATGAATGTTGCCCAACTCGCAACCATG
TCCAGTCTTCACTATCAAAATCTCGACTGGGACGACCCACCGGATGAGCTCTGCCCACGGCCTATTGACCTCATT
CTTGTCTCTGATTGTACCTACAATTCAGATAGCTTGCCCGCGCTAGTCTCTACGCTTGACCGATTGGTTCGGACC
TCCCCAGAGGCAATCGTCTTGGTGGCTCTGAAGAGACGACATGACAGCGAAACGGTGTTTTTCGACTTGATGCGC
TCGGCGAGATTTACGGCGGTGCAGGACAGCGTTGAAATCCCTTCGCAGCACGATGAGGTGGATGAAATTGAGTTT
TACTGCTACAGTCGATTAATTTAG
Gene >Pro_DTO377G3_2|g8271.t1
ATGGTCTACTATGTTAGATTCCTGAAAACCCCCAGAATCCAACAACAGAAAGGGGCCATCTACATCTCCGCTCTT
ATCTGCATCACCACTGATCTAGGGGACTCTTTTCTTGCTGAAGATGTTGATTTGATGGTGATAGCTGAGAATTCC
TCTCGAGTTATATTTCAGAAAACGACAAAATGGAATGCCAGTAATCGAGAACTTGCTATTACCCTGGGTCCTCTC
CCATCCAATCTGGCCCAGCAGTCTATGGTGTTGACGGTTAAAATGCCGGACTCACCAGAATATGTCATACCCCAG
TATTCCCCCATACAATTAGTGGTTGCTGCAACAAGTGCTCCATTTGGGCCTCATTCCACACCAGCAGAGAAGCTG
GTTCAACGCCGCCTTCAATACAGCGGCTGTGAACCATTCCCCATGGAAATATGGGAAGAGACAGGAAATAGCATT
GCTCGACACATATGGTAAGTCACTCTGCTACTTCCCTTTGGCTTTTTCCCTCGAGATTCTAAATACAAATTCCTA
GGGATGCGGGCCTAGCAACAGTTACATACCTTCACCTGATGTGTGAGGATATAAGGAAGACGGCCCGTAACAAGA
ACAAAGGCCCTGAACCTAAAATACAAGCTTTGAAGCAGGTCCTATCCGTCTGCAACCGACCTATCCAGGTAGTTG
AGCTTGGGGCAGGATGTGGGATAGCGGGAATTGCATTGGCATCAATGCTCCCGAATTGTTCGGTATTACTCACAG
ATCTCCCTGAGGTTGAGGAGATAATAACACGCAATATGAATGTTGCCCAACTCGCAACCATGTCCAGTCTTCACT
ATCAAAATCTCGACTGGGACGACCCACCGGATGAGCTCTGCCCACGGCCTATTGACCTCATTCTTGTCTCTGATT
GTACCTACAATTCAGATAGCTTGCCCGCGCTAGTCTCTACGCTTGACCGATTGGTTCGGACCTCCCCAGAGGCAA
TCGTCTTGGTGGCTCTGAAGAGACGACATGACAGCGAAACGGTGTTTTTCGACTTGATGCGCTCGGCGAGATTTA
CGGCGGTGCAGGACAGCGTTGAAATCCCTTCGCAGCACGATGAGGTGGATGAAATTGAGTTTTACTGCTACAGTC
GATTAATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail