Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8258.t1
Gene name
Locationscaffold_30:252836..256402
Strand-
Gene length (bp)3566
Transcript length (bp)3420
Coding sequence length (bp)3420
Protein length (aa) 1140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 6.9E-06 653 685
PF00806 PUF Pumilio-family RNA binding repeat 1.2E-01 688 722
PF00806 PUF Pumilio-family RNA binding repeat 3.2E-03 731 748
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.0E-09 447 505

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 54.86 33.54 76.17
5d_25C Five days - 25 degrees Celsius 59.99 36.58 83.41
7d_25C Seven days - 25 degrees Celsius 59.77 36.43 83.11
10d_25C Ten days - 25 degrees Celsius 60.88 37.03 84.73
7d_15C Seven days - 15 degrees Celsius 63.64 38.48 88.80
7d_30C Seven days - 30 degrees Celsius 62.48 38.06 86.90

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.756981 no
3d_25C 7d_25C 0.770033 no
3d_25C 7d_15C 0.576305 no
3d_25C 7d_30C 0.626806 no
3d_25C 10d_25C 0.711072 no
5d_25C 7d_25C 0.991742 no
5d_25C 7d_15C 0.850779 no
5d_25C 7d_30C 0.898846 no
5d_25C 10d_25C 0.965852 no
7d_25C 7d_15C 0.841398 no
7d_25C 7d_30C 0.889872 no
7d_25C 10d_25C 0.958896 no
7d_15C 7d_30C 0.958026 no
7d_15C 10d_25C 0.891804 no
7d_30C 10d_25C 0.939744 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8258.t1
MSGTSTGRSSPSDVAGSGNSRMSFGPSSGSIGSLRPGAGSPSHDLASRLYSKRAREIQAQEGLSPSIWGPPTSGH
STPLRENIPESPSQDSFPDLIPTSNGAMDSPGRRARAGTVPSRFPPMGTLNEMDFQQSYMPQTSRPTPSTSPFRP
PGVSGIDTSSIASSTGVANPASLSRLRAGSMPQKSNFLGGGGPFGPSLFSTNWSTGRERATTLTSIRSSEGPTSP
SHSSFSRDGLADTDVKTLDYLGLAETPQHGMASYGRPSMEALMQQQQQQASALPPLLAELAMMKSNNRFRSYSVN
AKEKYADDEDLEYENRYSQLPSGTMTPTAAATAAQLAATQAQIHQHNLAVQAFASHASVSRPRARTAGILEAPPQ
RSSIRNYLATPSRLDSSFSAADLQIPENGEYDELSEAVQLMHLSGNGIPAMGGRPAGEMADENNQDGPTRALWIG
SIPVSTTVTSLEAIFGMYGKIESTRVLTHKNCGFVNFDRLDSAVQAKSLLNGKEIFPGAGPVRIGYAKVPGASAT
GTPGANGTQSSPTPDPNFRSNVAATDGPDRADTNVIPQIPALADLLPEMVQIVQEFGASDDDLKNITASIQTSIA
FKAFKDEIPSVQETSQSRMFDAPRLRDIRKRIDNGACSIQEIEETAEAMLPEVAELASDYLGNTVVQKLFEFCSE
STKEQMLSHIAPHLSEIGVHKNGTWAAQKIIDVAKTPGQMQLIVDALRPYTVPLFLDQYGNYVLQCCLRFASPFN
SFIFESMLSRMWEIAQGRFGARAMRACLESHHATKDQQRMLASAIALHSVQLATNANGALLLTWFLDTCTFPRRR
TVLAPRLVPHLVHLCTHKVAYLTVLKVINQRNEPDARDIVLKALFFSPGDEVLEKILSDQTSGATLIFKVLTTPF
FDESMRTEVVKNVSKVLTKLKASPSQGYKRLMDEVGLSSRGSGREHHHGREHSTPEKSQHRQSSRHGSTGYPAQP
SIDRQQYNGQFTPNTFGQNPDNRPISADQSNPPPLDPYSNGLGNHMNGLASIGGYSQEPLSQQQLQYQAFLAAQA
RGVPTGYPAMPGANYGYPAGSTIDNLRSLQSQQASPLPGPGQMSPMLQNNYQQFSPVVNPAQMYQYPPQYYPQAQ
PVQGQSGGGRRGRR*
Coding >Pro_DTO377G3_2|g8258.t1
ATGTCGGGTACCTCGACGGGGCGCAGCTCTCCTAGCGATGTGGCCGGGTCTGGGAACTCAAGAATGTCCTTCGGG
CCTTCTTCGGGGTCCATTGGAAGTTTGAGGCCCGGGGCTGGCTCCCCTTCTCATGATTTGGCATCACGTCTGTAC
TCGAAGCGAGCCCGTGAAATTCAAGCTCAAGAAGGCCTTTCTCCTAGTATTTGGGGACCCCCTACCAGCGGCCAT
TCAACCCCGCTTCGCGAGAATATTCCCGAATCGCCGAGTCAAGATAGTTTTCCAGATTTGATTCCTACCAGCAAT
GGCGCCATGGACAGCCCTGGTCGCCGAGCTCGCGCTGGAACGGTTCCATCTCGTTTTCCTCCGATGGGCACACTG
AATGAGATGGATTTTCAGCAGTCTTATATGCCACAGACTTCACGACCAACACCCTCAACTAGTCCGTTTAGACCT
CCCGGTGTTTCCGGGATAGATACGAGTTCTATCGCGAGTTCGACTGGTGTGGCCAATCCGGCATCGCTATCTCGC
CTTCGAGCTGGCTCGATGCCGCAAAAAAGCAACTTCTTGGGAGGTGGCGGTCCCTTCGGTCCATCACTGTTTTCA
ACCAACTGGTCGACGGGTCGGGAGAGAGCTACAACTTTAACTAGTATTCGATCTTCGGAAGGGCCGACTTCGCCT
AGCCACTCATCTTTCTCGAGGGATGGACTCGCGGACACCGATGTGAAGACTTTGGATTATCTGGGACTCGCTGAG
ACCCCGCAACACGGAATGGCCTCCTATGGACGTCCGTCTATGGAAGCTTTGATGCAACAGCAGCAGCAGCAAGCT
TCTGCGCTGCCGCCACTCTTGGCTGAGTTGGCGATGATGAAGAGCAATAATCGATTCCGATCATACTCTGTCAAT
GCCAAGGAGAAGTACGCCGATGACGAGGATCTTGAATACGAGAACCGCTACTCCCAACTTCCCTCGGGTACTATG
ACGCCGACCGCCGCCGCGACCGCCGCGCAACTTGCCGCCACACAGGCCCAGATCCACCAGCATAATCTCGCGGTC
CAAGCTTTTGCCAGCCATGCCTCTGTCAGCCGACCCCGGGCGCGAACTGCTGGCATTTTGGAGGCACCTCCCCAG
CGATCATCCATCCGCAATTACCTTGCTACACCTTCCCGCCTCGACAGCAGTTTCAGTGCTGCTGATCTGCAGATT
CCCGAGAATGGTGAATACGACGAATTATCCGAGGCAGTTCAGCTGATGCATCTCAGCGGTAACGGTATTCCCGCT
ATGGGTGGCCGACCGGCCGGCGAGATGGCAGATGAGAACAACCAGGATGGGCCTACGCGGGCACTTTGGATTGGT
AGCATTCCCGTGTCCACCACTGTCACGTCTCTGGAGGCCATCTTTGGTATGTATGGAAAGATCGAGTCTACCCGT
GTTCTCACTCACAAGAACTGCGGGTTTGTCAACTTCGATCGCCTTGACAGCGCCGTGCAAGCCAAATCGCTGCTC
AATGGAAAGGAAATTTTCCCAGGCGCAGGCCCCGTCAGAATTGGTTACGCCAAGGTCCCTGGTGCATCGGCCACC
GGTACTCCTGGTGCAAACGGCACCCAGTCATCTCCCACTCCTGACCCGAACTTCAGATCAAATGTTGCAGCGACA
GATGGGCCGGATCGCGCGGATACTAATGTTATCCCTCAGATTCCCGCTCTGGCTGATCTGTTGCCTGAGATGGTG
CAAATTGTGCAAGAATTCGGCGCCAGTGATGATGACCTGAAGAACATCACGGCAAGCATCCAGACCTCCATCGCG
TTCAAGGCTTTCAAGGATGAAATCCCCTCGGTCCAGGAAACGAGTCAGTCCCGGATGTTCGACGCCCCTCGTCTC
CGTGACATCCGGAAGCGCATTGACAATGGTGCATGCTCGATCCAAGAAATTGAGGAGACTGCCGAGGCCATGCTC
CCTGAGGTTGCAGAGTTAGCGTCCGATTATTTGGGCAACACCGTGGTTCAGAAACTGTTTGAGTTCTGCTCTGAA
TCTACCAAGGAGCAGATGCTGTCTCACATTGCACCACATCTCTCCGAAATTGGTGTTCACAAGAATGGAACCTGG
GCTGCGCAGAAGATCATCGATGTCGCGAAGACTCCTGGACAGATGCAGTTAATTGTTGATGCTCTCCGCCCTTAT
ACTGTTCCTCTTTTCTTGGATCAGTATGGAAACTATGTCTTGCAATGCTGCCTGCGATTTGCCAGTCCCTTCAAT
AGCTTTATTTTCGAGTCCATGCTCAGCCGAATGTGGGAAATCGCCCAGGGACGTTTCGGCGCCCGAGCGATGCGG
GCTTGTCTCGAAAGCCACCATGCCACCAAGGATCAGCAGCGGATGCTTGCATCTGCTATCGCTCTCCACAGTGTG
CAGTTGGCTACTAATGCCAATGGAGCTCTTTTGCTCACTTGGTTCCTTGACACGTGCACATTCCCTCGCCGCCGA
ACAGTATTGGCCCCGAGACTTGTGCCTCACCTTGTTCACCTCTGCACCCACAAGGTTGCCTACCTGACGGTTCTC
AAGGTGATCAACCAGCGCAACGAGCCGGATGCTCGAGACATTGTTCTGAAGGCACTCTTCTTCAGTCCCGGCGAT
GAAGTTTTGGAGAAGATTCTGAGCGACCAGACATCTGGTGCGACTCTGATCTTCAAGGTCTTGACCACCCCATTC
TTTGACGAGTCTATGCGGACTGAGGTCGTGAAAAACGTTTCCAAGGTCCTCACAAAGCTCAAGGCTTCCCCAAGC
CAAGGCTATAAGCGTCTGATGGATGAAGTGGGCCTGTCCTCACGAGGTAGCGGTCGGGAGCATCACCATGGACGT
GAGCACTCCACCCCGGAGAAATCGCAACACCGTCAATCCTCTCGTCATGGAAGCACAGGTTATCCAGCCCAGCCA
TCCATTGACCGACAACAGTACAATGGGCAGTTTACTCCCAACACGTTTGGCCAGAACCCGGACAACCGCCCTATC
TCCGCCGATCAATCCAACCCCCCGCCCCTTGATCCATATTCCAACGGGCTCGGAAACCACATGAACGGTCTTGCC
AGTATAGGTGGATACAGCCAGGAACCCCTGAGCCAGCAACAGCTGCAATACCAAGCCTTCCTCGCCGCACAGGCT
CGCGGTGTTCCCACGGGCTATCCTGCCATGCCGGGCGCCAACTACGGCTACCCAGCTGGTTCGACCATCGATAAC
CTGCGATCTCTACAGTCGCAACAGGCTTCTCCCCTCCCCGGACCGGGCCAGATGAGTCCGATGCTCCAGAACAAC
TACCAACAGTTCAGCCCTGTTGTCAATCCTGCCCAGATGTATCAATACCCTCCGCAATACTACCCCCAGGCACAG
CCTGTGCAGGGACAGTCGGGCGGAGGCCGACGTGGACGGCGTTGA
Transcript >Pro_DTO377G3_2|g8258.t1
ATGTCGGGTACCTCGACGGGGCGCAGCTCTCCTAGCGATGTGGCCGGGTCTGGGAACTCAAGAATGTCCTTCGGG
CCTTCTTCGGGGTCCATTGGAAGTTTGAGGCCCGGGGCTGGCTCCCCTTCTCATGATTTGGCATCACGTCTGTAC
TCGAAGCGAGCCCGTGAAATTCAAGCTCAAGAAGGCCTTTCTCCTAGTATTTGGGGACCCCCTACCAGCGGCCAT
TCAACCCCGCTTCGCGAGAATATTCCCGAATCGCCGAGTCAAGATAGTTTTCCAGATTTGATTCCTACCAGCAAT
GGCGCCATGGACAGCCCTGGTCGCCGAGCTCGCGCTGGAACGGTTCCATCTCGTTTTCCTCCGATGGGCACACTG
AATGAGATGGATTTTCAGCAGTCTTATATGCCACAGACTTCACGACCAACACCCTCAACTAGTCCGTTTAGACCT
CCCGGTGTTTCCGGGATAGATACGAGTTCTATCGCGAGTTCGACTGGTGTGGCCAATCCGGCATCGCTATCTCGC
CTTCGAGCTGGCTCGATGCCGCAAAAAAGCAACTTCTTGGGAGGTGGCGGTCCCTTCGGTCCATCACTGTTTTCA
ACCAACTGGTCGACGGGTCGGGAGAGAGCTACAACTTTAACTAGTATTCGATCTTCGGAAGGGCCGACTTCGCCT
AGCCACTCATCTTTCTCGAGGGATGGACTCGCGGACACCGATGTGAAGACTTTGGATTATCTGGGACTCGCTGAG
ACCCCGCAACACGGAATGGCCTCCTATGGACGTCCGTCTATGGAAGCTTTGATGCAACAGCAGCAGCAGCAAGCT
TCTGCGCTGCCGCCACTCTTGGCTGAGTTGGCGATGATGAAGAGCAATAATCGATTCCGATCATACTCTGTCAAT
GCCAAGGAGAAGTACGCCGATGACGAGGATCTTGAATACGAGAACCGCTACTCCCAACTTCCCTCGGGTACTATG
ACGCCGACCGCCGCCGCGACCGCCGCGCAACTTGCCGCCACACAGGCCCAGATCCACCAGCATAATCTCGCGGTC
CAAGCTTTTGCCAGCCATGCCTCTGTCAGCCGACCCCGGGCGCGAACTGCTGGCATTTTGGAGGCACCTCCCCAG
CGATCATCCATCCGCAATTACCTTGCTACACCTTCCCGCCTCGACAGCAGTTTCAGTGCTGCTGATCTGCAGATT
CCCGAGAATGGTGAATACGACGAATTATCCGAGGCAGTTCAGCTGATGCATCTCAGCGGTAACGGTATTCCCGCT
ATGGGTGGCCGACCGGCCGGCGAGATGGCAGATGAGAACAACCAGGATGGGCCTACGCGGGCACTTTGGATTGGT
AGCATTCCCGTGTCCACCACTGTCACGTCTCTGGAGGCCATCTTTGGTATGTATGGAAAGATCGAGTCTACCCGT
GTTCTCACTCACAAGAACTGCGGGTTTGTCAACTTCGATCGCCTTGACAGCGCCGTGCAAGCCAAATCGCTGCTC
AATGGAAAGGAAATTTTCCCAGGCGCAGGCCCCGTCAGAATTGGTTACGCCAAGGTCCCTGGTGCATCGGCCACC
GGTACTCCTGGTGCAAACGGCACCCAGTCATCTCCCACTCCTGACCCGAACTTCAGATCAAATGTTGCAGCGACA
GATGGGCCGGATCGCGCGGATACTAATGTTATCCCTCAGATTCCCGCTCTGGCTGATCTGTTGCCTGAGATGGTG
CAAATTGTGCAAGAATTCGGCGCCAGTGATGATGACCTGAAGAACATCACGGCAAGCATCCAGACCTCCATCGCG
TTCAAGGCTTTCAAGGATGAAATCCCCTCGGTCCAGGAAACGAGTCAGTCCCGGATGTTCGACGCCCCTCGTCTC
CGTGACATCCGGAAGCGCATTGACAATGGTGCATGCTCGATCCAAGAAATTGAGGAGACTGCCGAGGCCATGCTC
CCTGAGGTTGCAGAGTTAGCGTCCGATTATTTGGGCAACACCGTGGTTCAGAAACTGTTTGAGTTCTGCTCTGAA
TCTACCAAGGAGCAGATGCTGTCTCACATTGCACCACATCTCTCCGAAATTGGTGTTCACAAGAATGGAACCTGG
GCTGCGCAGAAGATCATCGATGTCGCGAAGACTCCTGGACAGATGCAGTTAATTGTTGATGCTCTCCGCCCTTAT
ACTGTTCCTCTTTTCTTGGATCAGTATGGAAACTATGTCTTGCAATGCTGCCTGCGATTTGCCAGTCCCTTCAAT
AGCTTTATTTTCGAGTCCATGCTCAGCCGAATGTGGGAAATCGCCCAGGGACGTTTCGGCGCCCGAGCGATGCGG
GCTTGTCTCGAAAGCCACCATGCCACCAAGGATCAGCAGCGGATGCTTGCATCTGCTATCGCTCTCCACAGTGTG
CAGTTGGCTACTAATGCCAATGGAGCTCTTTTGCTCACTTGGTTCCTTGACACGTGCACATTCCCTCGCCGCCGA
ACAGTATTGGCCCCGAGACTTGTGCCTCACCTTGTTCACCTCTGCACCCACAAGGTTGCCTACCTGACGGTTCTC
AAGGTGATCAACCAGCGCAACGAGCCGGATGCTCGAGACATTGTTCTGAAGGCACTCTTCTTCAGTCCCGGCGAT
GAAGTTTTGGAGAAGATTCTGAGCGACCAGACATCTGGTGCGACTCTGATCTTCAAGGTCTTGACCACCCCATTC
TTTGACGAGTCTATGCGGACTGAGGTCGTGAAAAACGTTTCCAAGGTCCTCACAAAGCTCAAGGCTTCCCCAAGC
CAAGGCTATAAGCGTCTGATGGATGAAGTGGGCCTGTCCTCACGAGGTAGCGGTCGGGAGCATCACCATGGACGT
GAGCACTCCACCCCGGAGAAATCGCAACACCGTCAATCCTCTCGTCATGGAAGCACAGGTTATCCAGCCCAGCCA
TCCATTGACCGACAACAGTACAATGGGCAGTTTACTCCCAACACGTTTGGCCAGAACCCGGACAACCGCCCTATC
TCCGCCGATCAATCCAACCCCCCGCCCCTTGATCCATATTCCAACGGGCTCGGAAACCACATGAACGGTCTTGCC
AGTATAGGTGGATACAGCCAGGAACCCCTGAGCCAGCAACAGCTGCAATACCAAGCCTTCCTCGCCGCACAGGCT
CGCGGTGTTCCCACGGGCTATCCTGCCATGCCGGGCGCCAACTACGGCTACCCAGCTGGTTCGACCATCGATAAC
CTGCGATCTCTACAGTCGCAACAGGCTTCTCCCCTCCCCGGACCGGGCCAGATGAGTCCGATGCTCCAGAACAAC
TACCAACAGTTCAGCCCTGTTGTCAATCCTGCCCAGATGTATCAATACCCTCCGCAATACTACCCCCAGGCACAG
CCTGTGCAGGGACAGTCGGGCGGAGGCCGACGTGGACGGCGTTGA
Gene >Pro_DTO377G3_2|g8258.t1
ATGTCGGGTACCTCGACGGGGCGCAGCTCTCCTAGCGATGTGGCCGGGTCTGGGAACTCAAGAATGTCCTTCGGG
CCTTCTTCGGGGTCCATTGGAAGTTTGAGGCCCGGGGCTGGCTCCCCTTCTCATGATTTGGCATCACGTCTGTAC
TCGAAGCGGTAGGTTTGCTTCTTTACTTCCTGTGGGATATAACAGACACCGCGACAATTGGCTGATACTTTGACT
GTTCAAGCAGAGCCCGTGAAATTCAAGCTCAAGAAGGCCTTTCTCCTAGTATTTGGGGACCCCCTACCAGCGGCC
ATTCAACCCCGCTTCGCGAGAATATTCCCGAATCGCCGAGTCAAGATAGTTTTCCAGATTTGATTCCTACCAGCA
ATGGCGCCATGGACAGCCCTGGTCGCCGAGCTCGCGCTGGAACGGTTCCATCTCGTTTTCCTCCGATGGGCACAC
TGAATGAGATGGATTTTCAGCAGTCTTATATGCCACAGACTTCACGACCAACACCCTCAACTAGTCCGTTTAGAC
CTCCCGGTGTTTCCGGGATAGATACGAGTTCTATCGCGAGTTCGACTGGTGTGGCCAATCCGGCATCGCTATCTC
GCCTTCGAGCTGGCTCGATGCCGCAAAAAAGCAACTTCTTGGGAGGTGGCGGTCCCTTCGGTCCATCACTGTTTT
CAACCAACTGGTCGACGGGTCGGGAGAGAGCTACAACTTTAACTAGTATTCGATCTTCGGAAGGGCCGACTTCGC
CTAGCCACTCATCTTTCTCGAGGGATGGACTCGCGGACACCGATGTGAAGACTTTGGATTATCTGGGACTCGCTG
AGACCCCGCAACACGGAATGGCCTCCTATGGACGTCCGTCTATGGAAGCTTTGATGCAACAGCAGCAGCAGCAAG
CTTCTGCGCTGCCGCCACTCTTGGCTGAGTTGGCGATGATGAAGAGCAATAATCGATTCCGATCATACTCTGTCA
ATGCCAAGGAGAAGTACGCCGATGACGAGGATCTTGAATACGAGAACCGCTACTCCCAACTTCCCTCGGGTACTA
TGACGCCGACCGCCGCCGCGACCGCCGCGCAACTTGCCGCCACACAGGCCCAGATCCACCAGCATAATCTCGCGG
TCCAAGCTTTTGCCAGCCATGCCTCTGTCAGCCGACCCCGGGCGCGAACTGCTGGCATTTTGGAGGCACCTCCCC
AGCGATCATCCATCCGCAATTACCTTGCTACACCTTCCCGCCTCGACAGCAGTTTCAGTGCTGCTGATCTGCAGA
TTCCCGAGAATGGTGAATACGACGAATTATCCGAGGCAGTTCAGCTGATGCATCTCAGCGGTAACGGTATTCCCG
CTATGGGTGGCCGACCGGCCGGCGAGATGGCAGATGAGAACAACCAGGATGGGCCTACGCGGGCACTTTGGATTG
GTAGCATTCCCGTGTCCACCACTGTCACGTCTCTGGAGGCCATCTTTGGTATGTATGGAAAGATCGAGTCTACCC
GTGTTCTCACTCACAAGAACTGCGGGTTTGTCAACTTCGATCGCCTTGACAGCGCCGTGCAAGCCAAATCGCTGC
TCAATGGAAAGGAAATTTTCCCAGGCGCAGGCCCCGTCAGAATTGGTTACGCCAAGGTCCCTGGTGCATCGGCCA
CCGGTACTCCTGGTGCAAACGGCACCCAGTCATCTCCCACTCCTGACCCGAACTTCAGATCAAATGTTGCAGCGA
CAGATGGGCCGGATCGCGCGGATACTAATGTTATCCCTCAGATTCCCGCTCTGGCTGATCTGTTGCCTGAGATGG
TGCAAATTGTGCAAGAATTCGGCGCCAGTGATGATGACCTGAAGAACATCACGGCAAGCATCCAGACCTCCATCG
CGTTCAAGGCTTTCAAGGATGAAATCCCCTCGGTCCAGGAAACGAGTCAGTCCCGGATGTTCGACGCCCCTCGTC
TCCGTGACATCCGGAAGCGCATTGACAATGGTGCATGCTCGATCCAAGAAATTGAGGAGACTGCCGAGGCCATGC
TCCCTGAGGTTGCAGAGTTAGCGTCCGATTATTTGGGCAACACCGTGGTTCAGAAACTGTTTGAGTTCTGCTCTG
AATCTACCAAGGAGCAGATGCTGTCTCACATTGCACCACATCTCTCCGAAATTGGTGTTCACAAGAATGGAACCT
GGGCTGCGCAGAAGATCATCGATGTCGCGAAGACTCCTGGACAGATGCAGTTAATTGTTGATGCTCTCCGCCCTT
ATACTGTTCCTCTTTTCTTGGATCAGTATGGAAACTATGTCTTGCAATGCTGCCTGCGATTTGCCAGTCCCTTCA
ATAGCTTTATTTTCGAGTCCATGCTCAGCCGAATGTGGGAAATCGCCCAGGGACGTTTCGGCGCCCGAGCGATGC
GGGCTTGTCTCGAAAGCCACCATGCCACCAAGGATCAGCAGCGGATGCTTGCATCTGCTATCGCTCTCCACAGTG
TGCAGTTGGCTACTAATGCCAATGGAGCTCTTTTGCTCACTTGGTTCCTTGACACGTGCACATTCCCTCGCCGCC
GAACAGTATTGGCCCCGAGACTTGTGCCTCACCTTGTTCACCTCTGCACCCACAAGGTTGCCTACCTGACGGTTC
TCAAGGTGATCAACCAGCGCAACGAGCCGGATGCTCGAGACATTGTTCTGAAGGCACTCTTCTTCAGTCCCGGCG
ATGAAGTTTTGGAGAAGATTCTGAGCGACCAGACATCTGGTGCGACTCTGATCTTCAAGGTCTTGACCACCCCAT
TCTTTGACGAGTCTATGCGGACTGAGGTCGTGAAAAACGTTTCCAAGGTCCTCACAAAGCTCAAGGCTTCCCCAA
GCCAAGGCTATAAGCGTCTGATGGATGAAGTGGGCCTGTCCTCACGAGGTAGCGGTCGGGAGCATCACCATGGAC
GTGAGCACTCCACCCCGGAGAAATCGCAACACCGTCAATCCTCTCGTCATGGAAGCACAGGTTATCCAGCCCAGC
CATCCATTGACCGACAACAGTACAATGGGCAGTTTACTCCCAACACGTTTGGCCAGAACCCGGACAACCGCCCTA
TCTCCGCCGATCAATCCAACCCCCCGCCCCTTGATCCATATTCCAACGGGCTCGGAAACCACATGAACGGTCTTG
CCAGTATAGGTGGATACAGCCAGGAACCCCTGAGCCAGCAACAGCTGCAATACCAAGCCTTCCTCGCCGCACAGG
CTCGCGGTGTTCCCACGGGCTATCCTGCCATGCCGGGCGCCAACTACGGCTACCCAGCTGGTTCGACCATCGATA
ACCTGCGATCTCTACAGTCGCAACAGGCTTCTCCCCTCCCCGGACCGGGCCAGATGAGTCCGATGCTCCAGAACA
ACTACCAACAGTTCAGCCCTGTTGTCAATCCTGCCCAGATGTATCAATACCCTCCGCAATACTACCCCCAGGCAC
AGCCTGTGCAGGGACAGTCGGGCGGAGGCCGACGTGGACGGGTGAGTTCATTCTCGGATCGGCCCTAAACCGTAT
AATCCGCCGATACTAACGTGCATGCTTGCGTCCAGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail