Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8253.t1
Gene name
Locationscaffold_30:243246..244372
Strand+
Gene length (bp)1126
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05652 DcpS Scavenger mRNA decapping enzyme (DcpS) N-terminal 3.9E-34 15 127
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 8.1E-29 157 275

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0009056 catabolic process No
GO:0050789 regulation of biological process No
GO:0009057 macromolecule catabolic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0016071 mRNA metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0110154 RNA decapping No
GO:0009892 negative regulation of metabolic process No
GO:0016070 RNA metabolic process No
GO:0000956 nuclear-transcribed mRNA catabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0006402 mRNA catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006401 RNA catabolic process No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0019222 regulation of metabolic process No
GO:0110156 methylguanosine-cap decapping No
GO:0048519 negative regulation of biological process No
GO:0006807 nitrogen compound metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0044248 cellular catabolic process No
GO:0065007 biological regulation No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0010629 negative regulation of gene expression No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8253.t1
MADSAGTGKLAPEALITKFQVSKLLKQDQNGRRIALLGTIDNTQGILIAERAAFETESLAVLQAFHAAISRVNNL
GDNDIYRWYLASSNANNTAPTTPAEAANPQQDLKLNLIWPCTAQHIKKYSDQHLRMVTETAEIYRAHVRPFMQAK
REEGRLNWVFNILEGRTEQEDVVLRDEGLGPDDGFLMLPDLNWDRKSIGSLHLLALVQRRDIWSLRDLKKSFVPW
LKYLRGRVLEATVSMYPGLEEEQIKLYVHYQPTYYHFHIHVVNVMLEAGATQATGKAFGLENLISQLETLSGDGD
ASLADVDLTYFLGEANELWTDIFEPLKQGKQPREYKRAA*
Coding >Pro_DTO377G3_2|g8253.t1
ATGGCCGACTCTGCAGGCACCGGCAAGCTCGCCCCAGAGGCACTAATCACCAAATTTCAAGTGAGCAAGCTCCTC
AAACAAGACCAAAATGGCCGACGAATCGCCCTCCTAGGCACAATCGACAACACGCAAGGCATCCTAATAGCCGAG
CGCGCGGCATTCGAAACGGAATCCCTCGCCGTGCTACAAGCCTTCCACGCCGCAATCTCGCGAGTCAACAACCTA
GGCGACAACGACATCTACCGCTGGTATCTCGCGTCATCAAACGCCAACAACACGGCCCCGACCACTCCCGCGGAA
GCCGCGAACCCCCAGCAAGACCTCAAACTCAACCTCATCTGGCCATGCACCGCACAGCACATCAAGAAGTACTCG
GACCAGCATCTGCGCATGGTCACGGAGACGGCGGAGATATACCGTGCGCACGTGCGACCGTTCATGCAGGCGAAG
CGCGAGGAGGGGCGGCTGAACTGGGTGTTTAATATTCTTGAGGGCAGGACTGAGCAGGAGGATGTGGTTCTGCGG
GATGAGGGGCTCGGGCCTGATGATGGGTTTCTGATGTTACCGGATTTGAACTGGGATCGGAAGAGTATCGGGTCA
TTGCATTTGTTGGCTTTGGTGCAGAGGAGGGATATTTGGAGTTTGAGGGATCTGAAGAAGAGTTTTGTGCCTTGG
TTGAAATATTTGAGGGGGAGGGTGCTGGAGGCTACGGTTTCTATGTATCCTGGTTTGGAGGAGGAGCAGATTAAG
CTTTACGTTCATTATCAACCGACTTACTACCATTTCCATATTCATGTTGTCAATGTTATGCTCGAAGCTGGTGCA
ACGCAGGCAACGGGCAAGGCGTTTGGGCTGGAGAACTTGATCTCGCAGCTTGAGACTTTGTCTGGGGATGGGGAT
GCTAGTCTGGCCGATGTTGATTTGACATACTTCCTGGGCGAGGCCAATGAGCTGTGGACGGATATTTTTGAGCCG
TTGAAGCAGGGGAAGCAACCTCGTGAATATAAGAGAGCTGCTTGA
Transcript >Pro_DTO377G3_2|g8253.t1
ATGGCCGACTCTGCAGGCACCGGCAAGCTCGCCCCAGAGGCACTAATCACCAAATTTCAAGTGAGCAAGCTCCTC
AAACAAGACCAAAATGGCCGACGAATCGCCCTCCTAGGCACAATCGACAACACGCAAGGCATCCTAATAGCCGAG
CGCGCGGCATTCGAAACGGAATCCCTCGCCGTGCTACAAGCCTTCCACGCCGCAATCTCGCGAGTCAACAACCTA
GGCGACAACGACATCTACCGCTGGTATCTCGCGTCATCAAACGCCAACAACACGGCCCCGACCACTCCCGCGGAA
GCCGCGAACCCCCAGCAAGACCTCAAACTCAACCTCATCTGGCCATGCACCGCACAGCACATCAAGAAGTACTCG
GACCAGCATCTGCGCATGGTCACGGAGACGGCGGAGATATACCGTGCGCACGTGCGACCGTTCATGCAGGCGAAG
CGCGAGGAGGGGCGGCTGAACTGGGTGTTTAATATTCTTGAGGGCAGGACTGAGCAGGAGGATGTGGTTCTGCGG
GATGAGGGGCTCGGGCCTGATGATGGGTTTCTGATGTTACCGGATTTGAACTGGGATCGGAAGAGTATCGGGTCA
TTGCATTTGTTGGCTTTGGTGCAGAGGAGGGATATTTGGAGTTTGAGGGATCTGAAGAAGAGTTTTGTGCCTTGG
TTGAAATATTTGAGGGGGAGGGTGCTGGAGGCTACGGTTTCTATGTATCCTGGTTTGGAGGAGGAGCAGATTAAG
CTTTACGTTCATTATCAACCGACTTACTACCATTTCCATATTCATGTTGTCAATGTTATGCTCGAAGCTGGTGCA
ACGCAGGCAACGGGCAAGGCGTTTGGGCTGGAGAACTTGATCTCGCAGCTTGAGACTTTGTCTGGGGATGGGGAT
GCTAGTCTGGCCGATGTTGATTTGACATACTTCCTGGGCGAGGCCAATGAGCTGTGGACGGATATTTTTGAGCCG
TTGAAGCAGGGGAAGCAACCTCGTGAATATAAGAGAGCTGCTTGA
Gene >Pro_DTO377G3_2|g8253.t1
ATGGCCGACTCTGCAGGCACCGGCAAGCTCGCCCCAGAGGCACTAATCACCAAATTTCAAGTGAGCAAGCTCCTC
AAACAAGGTCCGACCCATCCACCTCCTACCCCGCAGCCTCAATGAACTAAAAGAAACCCAGACCAAAATGGCCGA
CGAATCGCCCTCCTAGGCACAATCGACAACACGCAAGGCATCCTAATAGCCGAGCGCGCGGCATTCGAAACGGAA
TCCCTCGCCGTGCTACAAGCCTTCCACGCCGCAATCTCGCGAGTCAACAACCTAGGCGACAACGACATCTACCGC
TGGTATCTCGCGTCATCAAACGCCAACAACACGGCCCCGACCACTCCCGCGGAAGCCGCGAACCCCCAGCAAGAC
CTCAAACTCAACCTCATCTGGCCATGCACCGCACAGCACATCAAGAAGTACTCGGACCAGCATCTGCGCATGGTC
ACGGAGACGGCGGAGATATACCGTGCGCACGTGCGACCGTTCATGCAGGCGAAGCGCGAGGAGGGGCGGCTGAAC
TGGGTGTTTAATATTCTTGAGGGCAGGACTGAGCAGGAGGATGTGGTTCTGCGGGATGAGGGGCTCGGGCCTGAT
GATGGGTTTCTGATGTTACCGGATTTGAACTGGGATCGGAAGAGTATCGGGTCATTGCATTTGTTGGCTTTGGTG
CAGAGGAGGGATATTTGGAGTTTGAGGGATCTGAAGAAGAGTTTTGTGCCTTGGTTGAAATATTTGAGGGGGAGG
GTGCTGGAGGCTACGGTTTCTATGTATCCTGGTTTGGAGGAGGAGCAGATTAAGCTTTACGTTCATTGTGAGTTG
CATTTCGTTACGTTGGTGGTTTTTTTGCTGACTTTGAATTTTAGATCAACCGACTTACTACCATTTCCATATTCA
TGTTGTCAATGTTATGCTCGAAGCTGGTGCAACGCAGGCAACGGGCAAGGCGTTTGGGCTGGAGAACTTGATCTC
GCAGCTTGAGACTTTGTCTGGGGATGGGGATGCTAGTCTGGCCGATGTTGATTTGACATACTTCCTGGGCGAGGC
CAATGAGCTGTGGACGGATATTTTTGAGCCGTTGAAGCAGGGGAAGCAACCTCGTGAATATAAGAGAGCTGCTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail