Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8249.t1
Gene name
Locationscaffold_30:236241..238788
Strand-
Gene length (bp)2547
Transcript length (bp)2373
Coding sequence length (bp)2373
Protein length (aa) 791

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11831 Myb_Cef pre-mRNA splicing factor component 6.8E-61 419 636
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 9.3E-11 7 52
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.9E-09 58 102
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 1.3E-13 9 69
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 1.2E-07 61 104

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 34.41 20.82 48.01
5d_25C Five days - 25 degrees Celsius 52.04 31.90 72.17
7d_25C Seven days - 25 degrees Celsius 59.03 36.05 82.01
10d_25C Ten days - 25 degrees Celsius 104.96 62.86 147.07
7d_15C Seven days - 15 degrees Celsius 41.01 24.64 57.39
7d_30C Seven days - 30 degrees Celsius 58.55 35.64 81.47

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.048064 yes
3d_25C 7d_25C 0.008807 yes
3d_25C 7d_15C 0.498120 no
3d_25C 7d_30C 0.006371 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.642759 no
5d_25C 7d_15C 0.314693 no
5d_25C 7d_30C 0.668150 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.098891 no
7d_25C 7d_30C 0.983056 no
7d_25C 10d_25C 0.003625 yes
7d_15C 7d_30C 0.105414 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.003625 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8249.t1
MPVVKGGVWTNIEDEVLRAAVSKYGLNQWARVSSLLARKTPKQCKARWIEWLDPGIRKVEWSREEDEKLLHLAKL
MPTQWRTIAPIVGRTATQCLERYQKLLDEAESRENDELGLGGPGEESAAPSADDVRRLRPGELDPDPESKPARPD
TIDLDEDEKEMLSEARARLANTQGKKAKRKARERQLEESRRLAVLQKRRELKHAGINVKVVTRKPGQMDYNADIP
FEKPAAPGFYDTLEEKDQNERQREAFDPRKQQLANKRKGDQDDDAERKKRKNDKSGTMAASAAAARAGQMQKIRE
AEQSSKRRGLNLPAPQVSESEMQDIIKMGMAGDKASQMTADETGTRGLIGNYSTIVGGTPIRTPRAAPEEDRIAN
EIKNIRALTETQSSLLGGDNTPLHEGSSSTGFDGIAPRRQAIVTPNPMATPFRQANGMGATPMPGGIGAGATPLR
TPRDHLALNREEQGAQLIGSTPRDIKMYENLTRQQVRSKLASLPKPKQAEWELEVPSESAEPTTSMEISEEDAAE
RDQRNKEAREKAAKAEFKRQSQVYQRGLPRPAVLDINALLQRASQVTGTIEGLIANEAAILIAHDSRKFPVPDAQ
IQGQAPKLSQLDDRFLDAARASIAAEIASTEAQLSEWQEKFDDGWSSARAKSLPGLENYEDDEQDPFQEEQRMIA
AFDTVQTSLFDTAERGNKLEKKLSLHYGGYQKRAKTLRSKILEAGAALPAAINELDAFRTLQISEESAVVRRLER
LREAVSFVMRREREAQDLYKSRKDELDELLAGTGTVNGWH*
Coding >Pro_DTO377G3_2|g8249.t1
ATGCCTGTCGTCAAAGGAGGTGTCTGGACCAATATTGAGGATGAAGTGCTTCGGGCAGCTGTATCCAAATATGGT
CTCAACCAATGGGCTCGAGTCTCCTCCCTGCTCGCACGGAAAACCCCAAAGCAATGCAAGGCGCGATGGATTGAA
TGGTTGGATCCGGGCATTCGCAAGGTCGAGTGGTCGCGGGAAGAGGACGAGAAACTGCTCCACCTTGCAAAGCTG
ATGCCCACTCAATGGCGCACTATTGCTCCCATCGTCGGGCGCACTGCCACACAATGTCTTGAACGCTACCAAAAG
CTGTTGGATGAAGCTGAATCTCGCGAGAATGACGAGCTCGGTCTCGGAGGACCTGGCGAGGAGAGCGCTGCCCCC
AGTGCGGACGATGTCCGTCGCCTGCGACCCGGTGAACTCGATCCCGACCCAGAGTCTAAGCCTGCCCGTCCCGAT
ACTATCGACCTGGATGAAGATGAGAAAGAAATGCTGAGCGAAGCGCGTGCTCGTCTCGCTAACACACAGGGTAAA
AAGGCCAAACGAAAGGCCCGAGAGCGTCAATTAGAAGAGTCACGTCGACTGGCCGTTCTCCAAAAGCGTCGCGAA
CTCAAGCATGCCGGTATTAACGTCAAGGTTGTCACGCGGAAGCCCGGTCAGATGGATTACAATGCAGACATTCCA
TTCGAAAAGCCAGCTGCTCCTGGATTCTACGATACACTCGAGGAGAAAGACCAGAATGAACGCCAACGAGAAGCG
TTCGATCCCCGGAAGCAGCAACTCGCAAATAAGAGAAAGGGAGACCAGGACGACGATGCGGAACGGAAGAAGCGC
AAGAACGATAAAAGCGGCACTATGGCCGCCTCTGCTGCAGCTGCACGAGCCGGCCAAATGCAGAAGATTCGCGAG
GCCGAACAGAGCAGCAAGCGACGGGGTTTGAACTTGCCAGCACCGCAGGTCAGCGAAAGCGAAATGCAAGATATC
ATCAAGATGGGAATGGCTGGGGATAAAGCTAGTCAAATGACCGCCGATGAAACAGGCACTCGGGGGCTTATTGGA
AATTACTCGACTATCGTTGGAGGAACTCCTATCAGAACCCCCCGAGCTGCGCCGGAGGAAGATCGCATCGCTAAC
GAAATCAAGAACATTCGAGCTTTGACTGAAACTCAGTCTTCCCTCCTGGGAGGGGATAACACACCTCTCCATGAG
GGCAGTTCATCAACTGGATTTGATGGCATTGCTCCTCGGCGGCAAGCGATCGTCACTCCCAACCCCATGGCCACG
CCATTCCGCCAGGCGAATGGCATGGGTGCGACACCTATGCCCGGTGGTATTGGGGCCGGTGCCACGCCATTGCGC
ACCCCACGTGACCATTTAGCTCTGAACCGGGAAGAACAGGGTGCCCAGCTCATTGGCAGCACACCCCGAGACATT
AAAATGTACGAGAATCTCACTCGCCAACAGGTGCGCAGCAAGCTGGCCTCGCTCCCCAAGCCCAAACAAGCCGAG
TGGGAATTAGAGGTTCCATCCGAATCCGCTGAGCCCACCACATCTATGGAGATCAGCGAAGAAGATGCGGCCGAG
CGTGATCAGCGTAACAAAGAGGCACGGGAGAAGGCCGCCAAGGCTGAATTCAAGCGTCAATCACAAGTTTACCAG
CGAGGCCTGCCTCGTCCCGCTGTTCTCGATATTAACGCTTTGCTGCAACGTGCGTCCCAGGTCACCGGCACCATC
GAAGGCCTGATTGCCAACGAAGCCGCCATTTTGATCGCACATGACTCTCGCAAATTCCCCGTCCCCGACGCGCAG
ATTCAAGGCCAAGCACCAAAGTTAAGCCAATTGGACGACCGTTTCTTGGACGCAGCACGAGCTTCTATTGCCGCT
GAGATTGCTTCCACCGAAGCACAGCTGTCCGAATGGCAAGAGAAATTCGACGACGGCTGGTCGTCAGCACGCGCC
AAGTCTCTGCCTGGCCTTGAGAACTACGAGGATGACGAGCAGGATCCCTTCCAAGAAGAACAACGCATGATCGCG
GCCTTTGATACTGTTCAAACTTCCCTCTTTGATACTGCCGAGCGCGGAAACAAGCTCGAGAAGAAGCTGTCTTTG
CACTACGGCGGATACCAGAAGCGGGCTAAGACGCTGCGGTCGAAGATCTTGGAGGCTGGTGCTGCTTTGCCCGCC
GCTATAAATGAGCTGGACGCTTTCCGTACACTCCAGATATCTGAGGAGTCGGCTGTGGTCCGGCGACTTGAGAGA
CTCCGGGAAGCAGTGTCATTTGTTATGCGGCGTGAGCGAGAGGCTCAAGATTTGTACAAGAGCCGAAAAGATGAG
CTTGATGAACTTCTTGCCGGGACGGGTACGGTCAATGGATGGCACTAG
Transcript >Pro_DTO377G3_2|g8249.t1
ATGCCTGTCGTCAAAGGAGGTGTCTGGACCAATATTGAGGATGAAGTGCTTCGGGCAGCTGTATCCAAATATGGT
CTCAACCAATGGGCTCGAGTCTCCTCCCTGCTCGCACGGAAAACCCCAAAGCAATGCAAGGCGCGATGGATTGAA
TGGTTGGATCCGGGCATTCGCAAGGTCGAGTGGTCGCGGGAAGAGGACGAGAAACTGCTCCACCTTGCAAAGCTG
ATGCCCACTCAATGGCGCACTATTGCTCCCATCGTCGGGCGCACTGCCACACAATGTCTTGAACGCTACCAAAAG
CTGTTGGATGAAGCTGAATCTCGCGAGAATGACGAGCTCGGTCTCGGAGGACCTGGCGAGGAGAGCGCTGCCCCC
AGTGCGGACGATGTCCGTCGCCTGCGACCCGGTGAACTCGATCCCGACCCAGAGTCTAAGCCTGCCCGTCCCGAT
ACTATCGACCTGGATGAAGATGAGAAAGAAATGCTGAGCGAAGCGCGTGCTCGTCTCGCTAACACACAGGGTAAA
AAGGCCAAACGAAAGGCCCGAGAGCGTCAATTAGAAGAGTCACGTCGACTGGCCGTTCTCCAAAAGCGTCGCGAA
CTCAAGCATGCCGGTATTAACGTCAAGGTTGTCACGCGGAAGCCCGGTCAGATGGATTACAATGCAGACATTCCA
TTCGAAAAGCCAGCTGCTCCTGGATTCTACGATACACTCGAGGAGAAAGACCAGAATGAACGCCAACGAGAAGCG
TTCGATCCCCGGAAGCAGCAACTCGCAAATAAGAGAAAGGGAGACCAGGACGACGATGCGGAACGGAAGAAGCGC
AAGAACGATAAAAGCGGCACTATGGCCGCCTCTGCTGCAGCTGCACGAGCCGGCCAAATGCAGAAGATTCGCGAG
GCCGAACAGAGCAGCAAGCGACGGGGTTTGAACTTGCCAGCACCGCAGGTCAGCGAAAGCGAAATGCAAGATATC
ATCAAGATGGGAATGGCTGGGGATAAAGCTAGTCAAATGACCGCCGATGAAACAGGCACTCGGGGGCTTATTGGA
AATTACTCGACTATCGTTGGAGGAACTCCTATCAGAACCCCCCGAGCTGCGCCGGAGGAAGATCGCATCGCTAAC
GAAATCAAGAACATTCGAGCTTTGACTGAAACTCAGTCTTCCCTCCTGGGAGGGGATAACACACCTCTCCATGAG
GGCAGTTCATCAACTGGATTTGATGGCATTGCTCCTCGGCGGCAAGCGATCGTCACTCCCAACCCCATGGCCACG
CCATTCCGCCAGGCGAATGGCATGGGTGCGACACCTATGCCCGGTGGTATTGGGGCCGGTGCCACGCCATTGCGC
ACCCCACGTGACCATTTAGCTCTGAACCGGGAAGAACAGGGTGCCCAGCTCATTGGCAGCACACCCCGAGACATT
AAAATGTACGAGAATCTCACTCGCCAACAGGTGCGCAGCAAGCTGGCCTCGCTCCCCAAGCCCAAACAAGCCGAG
TGGGAATTAGAGGTTCCATCCGAATCCGCTGAGCCCACCACATCTATGGAGATCAGCGAAGAAGATGCGGCCGAG
CGTGATCAGCGTAACAAAGAGGCACGGGAGAAGGCCGCCAAGGCTGAATTCAAGCGTCAATCACAAGTTTACCAG
CGAGGCCTGCCTCGTCCCGCTGTTCTCGATATTAACGCTTTGCTGCAACGTGCGTCCCAGGTCACCGGCACCATC
GAAGGCCTGATTGCCAACGAAGCCGCCATTTTGATCGCACATGACTCTCGCAAATTCCCCGTCCCCGACGCGCAG
ATTCAAGGCCAAGCACCAAAGTTAAGCCAATTGGACGACCGTTTCTTGGACGCAGCACGAGCTTCTATTGCCGCT
GAGATTGCTTCCACCGAAGCACAGCTGTCCGAATGGCAAGAGAAATTCGACGACGGCTGGTCGTCAGCACGCGCC
AAGTCTCTGCCTGGCCTTGAGAACTACGAGGATGACGAGCAGGATCCCTTCCAAGAAGAACAACGCATGATCGCG
GCCTTTGATACTGTTCAAACTTCCCTCTTTGATACTGCCGAGCGCGGAAACAAGCTCGAGAAGAAGCTGTCTTTG
CACTACGGCGGATACCAGAAGCGGGCTAAGACGCTGCGGTCGAAGATCTTGGAGGCTGGTGCTGCTTTGCCCGCC
GCTATAAATGAGCTGGACGCTTTCCGTACACTCCAGATATCTGAGGAGTCGGCTGTGGTCCGGCGACTTGAGAGA
CTCCGGGAAGCAGTGTCATTTGTTATGCGGCGTGAGCGAGAGGCTCAAGATTTGTACAAGAGCCGAAAAGATGAG
CTTGATGAACTTCTTGCCGGGACGGGTACGGTCAATGGATGGCACTAG
Gene >Pro_DTO377G3_2|g8249.t1
ATGCCTGTCGTCAAAGGAGGTGTCTGGTAAGTGCCACCGTTGGAACTCGCCCTCCAGTTCTCGTCGCTAATATAC
TCTTAGGACCAATATTGAGGATGAAGTGCTTCGGGCAGCTGTACGTGATATAACTCACTAGGAACCTCTCTAGCC
TACGTTTTATGAGCAAAAACTAACTCAATCGCAGGTATCCAAATATGGTCTCAACCAATGGGCTCGAGTCTCCTC
CCTGCTCGCACGGAAAACCCCAAAGCAATGCAAGGCGCGATGGATTGAATGGTTGGATCCGGGCATTCGCAAGGT
CGAGTGGTCGCGGGAAGAGGACGAGAAACTGCTCCACCTTGCAAAGCTGATGCCCACTCAATGGCGCACTATTGC
TCCCATCGTCGGGCGCACTGCCACACAATGTCTTGAACGCTACCAAAAGCTGTTGGATGAAGCTGAATCTCGCGA
GAATGACGAGCTCGGTCTCGGAGGACCTGGCGAGGAGAGCGCTGCCCCCAGTGCGGACGATGTCCGTCGCCTGCG
GTACGTTGGTTTTCCTAAAGCTCTGTGTTCGTGTTGCTGATACCTTTTAGACCCGGTGAACTCGATCCCGACCCA
GAGTCTAAGCCTGCCCGTCCCGATACTATCGACCTGGATGAAGATGAGAAAGAAATGCTGAGCGAAGCGCGTGCT
CGTCTCGCTAACACACAGGGTAAAAAGGCCAAACGAAAGGCCCGAGAGCGTCAATTAGAAGAGTCACGTCGACTG
GCCGTTCTCCAAAAGCGTCGCGAACTCAAGCATGCCGGTATTAACGTCAAGGTTGTCACGCGGAAGCCCGGTCAG
ATGGATTACAATGCAGACATTCCATTCGAAAAGCCAGCTGCTCCTGGATTCTACGATACACTCGAGGAGAAAGAC
CAGAATGAACGCCAACGAGAAGCGTTCGATCCCCGGAAGCAGCAACTCGCAAATAAGAGAAAGGGAGACCAGGAC
GACGATGCGGAACGGAAGAAGCGCAAGAACGATAAAAGCGGCACTATGGCCGCCTCTGCTGCAGCTGCACGAGCC
GGCCAAATGCAGAAGATTCGCGAGGCCGAACAGAGCAGCAAGCGACGGGGTTTGAACTTGCCAGCACCGCAGGTC
AGCGAAAGCGAAATGCAAGATATCATCAAGATGGGAATGGCTGGGGATAAAGCTAGTCAAATGACCGCCGATGAA
ACAGGCACTCGGGGGCTTATTGGAAATTACTCGACTATCGTTGGAGGAACTCCTATCAGAACCCCCCGAGCTGCG
CCGGAGGAAGATCGCATCGCTAACGAAATCAAGAACATTCGAGCTTTGACTGAAACTCAGTCTTCCCTCCTGGGA
GGGGATAACACACCTCTCCATGAGGGCAGTTCATCAACTGGATTTGATGGCATTGCTCCTCGGCGGCAAGCGATC
GTCACTCCCAACCCCATGGCCACGCCATTCCGCCAGGCGAATGGCATGGGTGCGACACCTATGCCCGGTGGTATT
GGGGCCGGTGCCACGCCATTGCGCACCCCACGTGACCATTTAGCTCTGAACCGGGAAGAACAGGGTGCCCAGCTC
ATTGGCAGCACACCCCGAGACATTAAAATGTACGAGAATCTCACTCGCCAACAGGTGCGCAGCAAGCTGGCCTCG
CTCCCCAAGCCCAAACAAGCCGAGTGGGAATTAGAGGTTCCATCCGAATCCGCTGAGCCCACCACATCTATGGAG
ATCAGCGAAGAAGATGCGGCCGAGCGTGATCAGCGTAACAAAGAGGCACGGGAGAAGGCCGCCAAGGCTGAATTC
AAGCGTCAATCACAAGTTTACCAGCGAGGCCTGCCTCGTCCCGCTGTTCTCGATATTAACGCTTTGCTGCAACGT
GCGTCCCAGGTCACCGGCACCATCGAAGGCCTGATTGCCAACGAAGCCGCCATTTTGATCGCACATGACTCTCGC
AAATTCCCCGTCCCCGACGCGCAGATTCAAGGCCAAGCACCAAAGTTAAGCCAATTGGACGACCGTTTCTTGGAC
GCAGCACGAGCTTCTATTGCCGCTGAGATTGCTTCCACCGAAGCACAGCTGTCCGAATGGCAAGAGAAATTCGAC
GACGGCTGGTCGTCAGCACGCGCCAAGTCTCTGCCTGGCCTTGAGAACTACGAGGATGACGAGCAGGATCCCTTC
CAAGAAGAACAACGCATGATCGCGGCCTTTGATACTGTTCAAACTTCCCTCTTTGATACTGCCGAGCGCGGAAAC
AAGCTCGAGAAGAAGCTGTCTTTGCACTACGGCGGATACCAGAAGCGGGCTAAGACGCTGCGGTCGAAGATCTTG
GAGGCTGGTGCTGCTTTGCCCGCCGCTATAAATGAGCTGGACGCTTTCCGTACACTCCAGATATCTGAGGAGTCG
GCTGTGGTCCGGCGACTTGAGAGACTCCGGGAAGCAGTGTCATTTGTTATGCGGCGTGAGCGAGAGGCTCAAGAT
TTGTACAAGAGCCGAAAAGATGAGCTTGATGAACTTCTTGCCGGGACGGGTACGGTCAATGGATGGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail