Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8239.t1
Gene name
Locationscaffold_30:211086..214344
Strand-
Gene length (bp)3258
Transcript length (bp)3102
Coding sequence length (bp)3102
Protein length (aa) 1034

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 6.0E-47 176 384
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.1E-42 832 1016
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.3E-19 400 761
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 1.8E-17 19 84
PF13246 Cation_ATPase Cation transport ATPase (P-type) 7.8E-13 479 566

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 325 344 19
2 357 379 22
3 808 830 22
4 879 901 22
5 961 983 22
6 990 1009 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8239.t1
MTGRPNAPSSTSTSTYSWLEPHETAERLRTSILHGLTPVEAEIRLARDGPNELPHDEPEPLWLRFLKQFKETLIL
LLLGSAGISFVMGNYDDAISITLAVTIVVTVGFVQEYRSEKSLEALSRLVPHYAHLIRDIPTSSSAVTENGGSSP
PGFSMEMDEIRSKSPGSASAAVKASSTVPANELVPGDLVLFTTGDRIPADIRITAATDLSIDESNLTGENEPVAK
YTEALRTTSGGTASAPKGIAPPRSPFYDAPASGAVGADIRLNEQHNVAFMGTLVRSGYGQGIVISTGANTEFGSI
SASLQEIESPRTPLQLSMDRLGQELSYISFGVIGLIVVIGLIQGRKILEMFTIGVSLAVAAIPEGLPIIVTVTLA
LGVLRMAKRGAIMRRLPSVETLGSVNVVCSDKTGTLTLNHMTVTKMWHFDCPEPFDVQREMTSVTSFGPAAQTIL
RVGNIANNSRLSRMHANSPASASSATVLSSTINSDSAAAKSRWVGQPTDVAILDLMDILGEDDVRDRISARVHET
PFSSERKWMGVVIGDSGGSNGGPHVAYIKGALEQVLARSDTYLTKDGREVILDEPRRKIIREAAENMASEGLRVL
AFGSGVVRDTSRGGRGFGSRSSPKIVQGDDDERYNGLVFAGLVGMNDPPRKDVHKSIRRLMSGGVRVIMITGDAE
TTAVAIAKKLGMPVNDSPHARSVIGGDELDRMTAAELAQAISTVSIFARTSPDHKMKIVTALQARGDVVAMTGDG
VNDAPALKKADIGISMGKLGTDVAKEAADMILTDDDFSTILQAIEQGKGIFYNIQNFITFQLSTSVAALSLVLLS
TTLGFKNPLNAMQILWINILMDGPPAQSLGVEPVDPTIMNRPPRPKTARVLTKPLIQRVLTSAMVIMVGTLSIYI
QEMGDITDGNPVEKRSRVVTAHDTTMTFTCFVLFDMFNALTCRSEGKSVLRGEMPLFGNKMFNYAVLGSLAGQAC
VIYLPFLQRIFQTEALAFGSLVKLVCIASSVFWVDEGRKYLHAIRRRRGVGSGYSVNV*
Coding >Pro_DTO377G3_2|g8239.t1
ATGACTGGACGGCCAAATGCTCCATCATCAACATCCACTTCCACATATTCATGGCTCGAGCCTCATGAAACTGCC
GAGCGATTACGAACCTCTATTTTACATGGCCTGACACCCGTCGAGGCAGAGATACGCTTAGCCAGAGATGGACCG
AACGAGCTTCCTCACGATGAGCCGGAACCCCTCTGGCTGCGGTTCCTCAAACAATTCAAGGAGACGCTGATTCTC
CTCCTCCTCGGCTCTGCTGGAATCTCTTTTGTGATGGGCAACTACGACGATGCCATCAGCATTACTCTCGCAGTA
ACAATTGTTGTGACTGTTGGCTTTGTTCAAGAGTATCGGTCGGAGAAGTCGTTGGAAGCATTGAGCCGACTTGTA
CCTCATTATGCGCATTTGATCCGTGATATTCCAACAAGTTCCTCCGCGGTGACTGAGAATGGTGGTTCATCGCCC
CCAGGTTTCTCCATGGAAATGGATGAAATTCGGAGCAAAAGCCCAGGCTCGGCGTCTGCCGCGGTCAAGGCTTCT
TCAACAGTCCCCGCGAACGAACTTGTACCCGGAGATTTGGTTCTTTTCACTACTGGAGACCGCATTCCCGCCGAT
ATTCGAATCACTGCTGCAACAGATCTGAGCATTGACGAGTCGAACTTGACTGGAGAGAACGAGCCTGTAGCGAAG
TACACGGAAGCTTTGCGCACCACATCTGGCGGGACCGCTTCAGCGCCAAAAGGAATAGCACCCCCTCGATCTCCC
TTCTACGATGCACCGGCAAGCGGTGCTGTTGGTGCTGACATTCGGTTGAACGAGCAGCACAATGTTGCGTTCATG
GGTACCCTAGTCCGCTCAGGCTATGGTCAGGGAATTGTTATCTCAACCGGCGCAAATACGGAGTTCGGCAGTATA
TCAGCTTCGCTACAAGAGATCGAGAGCCCTCGAACACCATTACAACTGTCCATGGATCGTTTGGGACAGGAGCTA
AGTTATATATCTTTCGGTGTCATTGGATTGATCGTGGTTATTGGTCTTATACAAGGTCGCAAGATTCTCGAAATG
TTCACGATAGGTGTCTCGCTGGCCGTCGCAGCGATCCCAGAAGGCTTGCCTATCATTGTTACTGTCACGCTCGCG
CTCGGCGTCCTGCGCATGGCTAAGAGGGGAGCAATCATGCGAAGACTGCCCAGCGTTGAAACTCTTGGCTCTGTC
AATGTCGTCTGCTCGGACAAGACTGGAACTCTTACTCTCAACCATATGACAGTCACCAAAATGTGGCATTTCGAC
TGCCCAGAACCATTCGACGTGCAAAGAGAAATGACGTCAGTTACTTCTTTTGGCCCTGCGGCGCAAACAATCCTG
CGCGTTGGTAATATTGCAAACAACTCTCGTTTGTCACGGATGCACGCAAACTCGCCGGCCAGCGCATCTTCTGCG
ACTGTACTTTCGTCGACCATCAACAGTGATTCGGCTGCTGCCAAGAGTCGATGGGTGGGTCAGCCCACTGATGTG
GCAATTTTGGATCTAATGGATATCCTCGGAGAAGATGATGTGCGCGATCGTATCAGCGCTCGCGTCCATGAGACC
CCATTCAGCTCCGAGCGGAAATGGATGGGTGTTGTTATCGGCGATTCTGGTGGTTCAAATGGAGGTCCCCATGTT
GCCTATATTAAGGGTGCTCTCGAACAGGTCTTGGCGCGATCGGATACCTATCTCACCAAGGATGGTCGGGAAGTA
ATTCTAGACGAGCCCCGTCGCAAGATTATTCGGGAAGCAGCAGAGAACATGGCATCGGAGGGTCTTAGAGTTCTT
GCCTTTGGCAGTGGAGTTGTTCGTGATACTTCTAGAGGTGGCAGAGGCTTTGGCAGTCGGTCGTCCCCGAAAATC
GTACAAGGTGATGATGACGAGCGGTACAACGGCTTAGTCTTTGCTGGATTAGTGGGCATGAACGACCCGCCGCGT
AAAGATGTGCACAAATCCATCCGACGCTTGATGTCTGGTGGTGTCAGAGTCATCATGATTACTGGCGACGCTGAG
ACAACAGCTGTGGCCATTGCGAAGAAGCTTGGAATGCCAGTTAACGATTCCCCGCATGCCCGTTCAGTCATCGGA
GGCGATGAACTCGATCGTATGACTGCCGCTGAACTTGCCCAGGCAATCTCAACGGTCTCGATCTTTGCCCGTACG
AGCCCAGACCACAAGATGAAGATTGTGACAGCACTTCAAGCCCGCGGCGATGTAGTTGCCATGACCGGTGATGGT
GTCAACGATGCGCCCGCTCTGAAGAAAGCTGACATAGGTATTTCCATGGGCAAGCTAGGCACCGACGTTGCCAAA
GAGGCAGCGGACATGATTTTGACAGATGACGATTTCTCGACCATCTTGCAGGCAATCGAACAGGGCAAGGGCATC
TTCTATAACATCCAGAATTTCATTACGTTCCAGCTTAGTACCAGCGTGGCTGCACTCAGTCTTGTACTGCTGAGC
ACCACTCTTGGCTTCAAGAATCCGCTGAATGCTATGCAGATATTGTGGATCAATATTCTTATGGATGGCCCACCC
GCCCAGTCCCTAGGCGTCGAGCCCGTCGACCCTACCATCATGAATCGCCCGCCACGACCCAAGACGGCCCGTGTT
CTGACAAAACCTCTAATCCAGCGCGTCCTCACCTCAGCCATGGTCATCATGGTTGGCACGTTGTCAATCTACATC
CAAGAAATGGGCGATATCACCGACGGTAACCCAGTCGAAAAGCGCTCCCGCGTCGTCACCGCGCACGACACCACC
ATGACATTCACCTGCTTCGTTTTATTCGACATGTTCAACGCATTGACATGCCGCAGCGAGGGCAAGTCCGTCCTA
CGTGGTGAAATGCCGCTGTTTGGGAACAAGATGTTCAATTACGCTGTTCTTGGCTCGTTGGCCGGCCAGGCCTGC
GTGATCTACCTGCCGTTCCTGCAGCGCATCTTCCAGACCGAGGCTCTCGCCTTCGGGTCCTTGGTCAAGCTGGTC
TGCATTGCCAGTTCGGTGTTCTGGGTGGATGAAGGTCGCAAGTATCTGCATGCGATCCGTCGTCGGCGTGGGGTG
GGTTCTGGTTATAGCGTCAATGTCTGA
Transcript >Pro_DTO377G3_2|g8239.t1
ATGACTGGACGGCCAAATGCTCCATCATCAACATCCACTTCCACATATTCATGGCTCGAGCCTCATGAAACTGCC
GAGCGATTACGAACCTCTATTTTACATGGCCTGACACCCGTCGAGGCAGAGATACGCTTAGCCAGAGATGGACCG
AACGAGCTTCCTCACGATGAGCCGGAACCCCTCTGGCTGCGGTTCCTCAAACAATTCAAGGAGACGCTGATTCTC
CTCCTCCTCGGCTCTGCTGGAATCTCTTTTGTGATGGGCAACTACGACGATGCCATCAGCATTACTCTCGCAGTA
ACAATTGTTGTGACTGTTGGCTTTGTTCAAGAGTATCGGTCGGAGAAGTCGTTGGAAGCATTGAGCCGACTTGTA
CCTCATTATGCGCATTTGATCCGTGATATTCCAACAAGTTCCTCCGCGGTGACTGAGAATGGTGGTTCATCGCCC
CCAGGTTTCTCCATGGAAATGGATGAAATTCGGAGCAAAAGCCCAGGCTCGGCGTCTGCCGCGGTCAAGGCTTCT
TCAACAGTCCCCGCGAACGAACTTGTACCCGGAGATTTGGTTCTTTTCACTACTGGAGACCGCATTCCCGCCGAT
ATTCGAATCACTGCTGCAACAGATCTGAGCATTGACGAGTCGAACTTGACTGGAGAGAACGAGCCTGTAGCGAAG
TACACGGAAGCTTTGCGCACCACATCTGGCGGGACCGCTTCAGCGCCAAAAGGAATAGCACCCCCTCGATCTCCC
TTCTACGATGCACCGGCAAGCGGTGCTGTTGGTGCTGACATTCGGTTGAACGAGCAGCACAATGTTGCGTTCATG
GGTACCCTAGTCCGCTCAGGCTATGGTCAGGGAATTGTTATCTCAACCGGCGCAAATACGGAGTTCGGCAGTATA
TCAGCTTCGCTACAAGAGATCGAGAGCCCTCGAACACCATTACAACTGTCCATGGATCGTTTGGGACAGGAGCTA
AGTTATATATCTTTCGGTGTCATTGGATTGATCGTGGTTATTGGTCTTATACAAGGTCGCAAGATTCTCGAAATG
TTCACGATAGGTGTCTCGCTGGCCGTCGCAGCGATCCCAGAAGGCTTGCCTATCATTGTTACTGTCACGCTCGCG
CTCGGCGTCCTGCGCATGGCTAAGAGGGGAGCAATCATGCGAAGACTGCCCAGCGTTGAAACTCTTGGCTCTGTC
AATGTCGTCTGCTCGGACAAGACTGGAACTCTTACTCTCAACCATATGACAGTCACCAAAATGTGGCATTTCGAC
TGCCCAGAACCATTCGACGTGCAAAGAGAAATGACGTCAGTTACTTCTTTTGGCCCTGCGGCGCAAACAATCCTG
CGCGTTGGTAATATTGCAAACAACTCTCGTTTGTCACGGATGCACGCAAACTCGCCGGCCAGCGCATCTTCTGCG
ACTGTACTTTCGTCGACCATCAACAGTGATTCGGCTGCTGCCAAGAGTCGATGGGTGGGTCAGCCCACTGATGTG
GCAATTTTGGATCTAATGGATATCCTCGGAGAAGATGATGTGCGCGATCGTATCAGCGCTCGCGTCCATGAGACC
CCATTCAGCTCCGAGCGGAAATGGATGGGTGTTGTTATCGGCGATTCTGGTGGTTCAAATGGAGGTCCCCATGTT
GCCTATATTAAGGGTGCTCTCGAACAGGTCTTGGCGCGATCGGATACCTATCTCACCAAGGATGGTCGGGAAGTA
ATTCTAGACGAGCCCCGTCGCAAGATTATTCGGGAAGCAGCAGAGAACATGGCATCGGAGGGTCTTAGAGTTCTT
GCCTTTGGCAGTGGAGTTGTTCGTGATACTTCTAGAGGTGGCAGAGGCTTTGGCAGTCGGTCGTCCCCGAAAATC
GTACAAGGTGATGATGACGAGCGGTACAACGGCTTAGTCTTTGCTGGATTAGTGGGCATGAACGACCCGCCGCGT
AAAGATGTGCACAAATCCATCCGACGCTTGATGTCTGGTGGTGTCAGAGTCATCATGATTACTGGCGACGCTGAG
ACAACAGCTGTGGCCATTGCGAAGAAGCTTGGAATGCCAGTTAACGATTCCCCGCATGCCCGTTCAGTCATCGGA
GGCGATGAACTCGATCGTATGACTGCCGCTGAACTTGCCCAGGCAATCTCAACGGTCTCGATCTTTGCCCGTACG
AGCCCAGACCACAAGATGAAGATTGTGACAGCACTTCAAGCCCGCGGCGATGTAGTTGCCATGACCGGTGATGGT
GTCAACGATGCGCCCGCTCTGAAGAAAGCTGACATAGGTATTTCCATGGGCAAGCTAGGCACCGACGTTGCCAAA
GAGGCAGCGGACATGATTTTGACAGATGACGATTTCTCGACCATCTTGCAGGCAATCGAACAGGGCAAGGGCATC
TTCTATAACATCCAGAATTTCATTACGTTCCAGCTTAGTACCAGCGTGGCTGCACTCAGTCTTGTACTGCTGAGC
ACCACTCTTGGCTTCAAGAATCCGCTGAATGCTATGCAGATATTGTGGATCAATATTCTTATGGATGGCCCACCC
GCCCAGTCCCTAGGCGTCGAGCCCGTCGACCCTACCATCATGAATCGCCCGCCACGACCCAAGACGGCCCGTGTT
CTGACAAAACCTCTAATCCAGCGCGTCCTCACCTCAGCCATGGTCATCATGGTTGGCACGTTGTCAATCTACATC
CAAGAAATGGGCGATATCACCGACGGTAACCCAGTCGAAAAGCGCTCCCGCGTCGTCACCGCGCACGACACCACC
ATGACATTCACCTGCTTCGTTTTATTCGACATGTTCAACGCATTGACATGCCGCAGCGAGGGCAAGTCCGTCCTA
CGTGGTGAAATGCCGCTGTTTGGGAACAAGATGTTCAATTACGCTGTTCTTGGCTCGTTGGCCGGCCAGGCCTGC
GTGATCTACCTGCCGTTCCTGCAGCGCATCTTCCAGACCGAGGCTCTCGCCTTCGGGTCCTTGGTCAAGCTGGTC
TGCATTGCCAGTTCGGTGTTCTGGGTGGATGAAGGTCGCAAGTATCTGCATGCGATCCGTCGTCGGCGTGGGGTG
GGTTCTGGTTATAGCGTCAATGTCTGA
Gene >Pro_DTO377G3_2|g8239.t1
ATGACTGGACGGCCAAATGCTCCATCATCAGTAAGTATACTTGACTCACGTACCACGTGTGCTGCCCTTCCTCCA
CTTCTTCACGCCGTCAGACAATGGAGTTTCTAACACATGGTCTTGTTTTCTTCCAGACATCCACTTCCACATATT
CATGGCTCGAGCCTCATGAAACTGCCGAGCGATTACGAACCTCTATTTTACATGGCCTGACACCCGTCGAGGCAG
AGATACGCTTAGCCAGAGATGGACCGAACGAGCTTCCTCACGATGAGCCGGAACCCCTCTGGCTGCGGTTCCTCA
AACAATTCAAGGAGACGCTGATTCTCCTCCTCCTCGGCTCTGCTGGAATCTCTTTTGTGATGGGCAACTACGACG
ATGCCATCAGCATTACTCTCGCAGTAACAATTGTTGTGACTGTTGGCTTTGTTCAAGAGTATCGGTCGGAGAAGT
CGTTGGAAGCATTGAGCCGACTTGTACCTCATTATGCGCATTTGATCCGTGATATTCCAACAAGTTCCTCCGCGG
TGACTGAGAATGGTGGTTCATCGCCCCCAGGTTTCTCCATGGAAATGGATGAAATTCGGAGCAAAAGCCCAGGCT
CGGCGTCTGCCGCGGTCAAGGCTTCTTCAACAGTCCCCGCGAACGAACTTGTACCCGGAGATTTGGTTCTTTTCA
CTACTGGAGACCGCATTCCCGCCGATATTCGAATCACTGCTGCAACAGATCTGAGCATTGACGAGTCGAACTTGA
CTGGAGAGAACGAGCCTGTAGCGAAGTACACGGAAGCTTTGCGCACCACATCTGGCGGGACCGCTTCAGCGCCAA
AAGGAATAGCACCCCCTCGATCTCCCTTCTACGATGCACCGGCAAGCGGTGCTGTTGGTGCTGACATTCGGTTGA
ACGAGCAGCACAATGTTGCGTTCATGGGTACCCTAGTCCGCTCAGGCTATGGTCAGGGAATTGTTATCTCAACCG
GCGCAAATACGGAGTTCGGCAGTATATCAGCTTCGCTACAAGAGATCGAGAGCCCTCGAACACCATTACAACTGT
CCATGGATCGTTTGGGACAGGAGCTAAGTTATATATCTTTCGGTGTCATTGGATTGATCGTGGTTATTGGTCTTA
TACAAGGTCGCAAGATTCTCGAAATGTTCACGATAGGTGTCTCGCTGGCCGTCGCAGCGATCCCAGAAGGCTTGC
CTATCATTGTTACTGTCACGCTCGCGCTCGGCGTCCTGCGCATGGCTAAGAGGGGAGCAATCATGCGAAGACTGC
CCAGCGTTGAAACTCTTGGCTCTGTCAATGTCGTCTGCTCGGACAAGACTGGAACTCTTACTCTCAACCATATGA
CAGTCACCAAAATGTGGCATTTCGACTGCCCAGAACCATTCGACGTGCAAAGAGAAATGACGTCAGTTACTTCTT
TTGGCCCTGCGGCGCAAACAATCCTGCGCGTTGGTAATATTGCAAACAACTCTCGTTTGTCACGGATGCACGCAA
ACTCGCCGGCCAGCGCATCTTCTGCGACTGTACTTTCGTCGACCATCAACAGTGATTCGGCTGCTGCCAAGAGTC
GATGGGTGGGTCAGCCCACTGATGTGGCAATTTTGGATCTAATGGATATCCTCGGAGAAGATGATGTGCGCGATC
GTATCAGCGCTCGCGTCCATGAGACCCCATTCAGCTCCGAGCGGAAATGGATGGGTGTTGTTATCGGCGATTCTG
GTGGTTCAAATGGAGGTCCCCATGTTGCCTATATTAAGGGTGCTCTCGAACAGGTCTTGGCGCGATCGGATACCT
ATCTCACCAAGGATGGTCGGGAAGTAATTCTAGACGAGCCCCGTCGCAAGATTATTCGGGAAGCAGCAGAGAACA
TGGCATCGGAGGGTCTTAGAGTTCTTGCCTTTGGCAGTGGAGTTGTTCGTGATACTTCTAGAGGTGGCAGAGGCT
TTGGCAGTCGGTCGTCCCCGAAAATCGTACAAGGTGATGATGACGAGCGGTACAACGGCTTAGTCTTTGCTGGAT
TAGTGGGCATGAACGACCCGCCGCGTAAAGATGTGCACAAATCCATCCGACGCTTGATGTCTGGTGGTGTCAGAG
TCATCATGATTACTGGCGACGCTGAGACAACAGCTGTGGCCATTGCGAAGAAGCTTGGAATGCCAGTTAACGATT
CCCCGCATGCCCGTTCAGTCATCGGAGGCGATGAACTCGATCGTATGACTGCCGCTGAACTTGCCCAGGCAATCT
CAACGGTCTCGATCTTTGCCCGTACGAGCCCAGACCACAAGATGAAGATTGTGACAGCACTTCAAGCCCGCGGCG
ATGTAGTTGCCATGACCGGTGATGGTGTCAACGATGCGCCCGCTCTGAAGAAAGCTGACATAGGTATTTCCATGG
GCAAGCTAGGCACCGACGTTGCCAAAGAGGCAGCGGACATGATTTTGACAGATGACGATTTCTCGACCATCTTGC
AGGCAATCGAACAGGGCAAGGGCATCTTCTATAACATCCAGAATTTCATTACGTTCCAGCTTAGTACCAGCGTGG
CTGCACTCAGTCTTGTACTGCTGAGCACCACTCTTGGCTTCAAGAATCCGCTGAATGCTATGCAGATATTGTGGA
TCAGTGAGTATTCCTGCATCCGATTCTATCCCTTGTATTTCACTAACAACTATTACAGATATTCTTATGGATGGC
CCACCCGCCCAGTCCCTAGGCGTCGAGCCCGTCGACCCTACCATCATGAATCGCCCGCCACGACCCAAGACGGCC
CGTGTTCTGACAAAACCTCTAATCCAGCGCGTCCTCACCTCAGCCATGGTCATCATGGTTGGCACGTTGTCAATC
TACATCCAAGAAATGGGCGATATCACCGACGGTAACCCAGTCGAAAAGCGCTCCCGCGTCGTCACCGCGCACGAC
ACCACCATGACATTCACCTGCTTCGTTTTATTCGACATGTTCAACGCATTGACATGCCGCAGCGAGGGCAAGTCC
GTCCTACGTGGTGAAATGCCGCTGTTTGGGAACAAGATGTTCAATTACGCTGTTCTTGGCTCGTTGGCCGGCCAG
GCCTGCGTGATCTACCTGCCGTTCCTGCAGCGCATCTTCCAGACCGAGGCTCTCGCCTTCGGGTCCTTGGTCAAG
CTGGTCTGCATTGCCAGTTCGGTGTTCTGGGTGGATGAAGGTCGCAAGTATCTGCATGCGATCCGTCGTCGGCGT
GGGGTGGGTTCTGGTTATAGCGTCAATGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail