Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8222.t1
Gene name
Locationscaffold_30:159448..161614
Strand-
Gene length (bp)2166
Transcript length (bp)2166
Coding sequence length (bp)2166
Protein length (aa) 722

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 8.1E-63 292 536
PF06738 ThrE Putative threonine/serine exporter 3.9E-07 566 650
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 4.2E-12 567 707

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 399 417 18
2 424 446 22
3 451 470 19
4 477 499 22
5 514 536 22
6 556 578 22
7 607 629 22
8 636 658 22
9 688 710 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8222.t1
MSDAQEKAPPIPPHPSAGTAEADRAEGSDHNVDSNAETLRPDEAHPEPETLYQRCRAAGRRIRNRAVIIAEMLGR
PHEKGDGLNSPMLPDYYETLDDIRAYEARQALDEEARLPGTDYDSQARLLMEQMGSQSRLRRPHHIKEPCSGSTT
PGTPGTPDESAGPGSPPGGLLSHLLRVYADNLHAARLSSMSTASEPSPDAEPKPDAEPIALPDTTTGEKKDKSKW
YNHPNKPSHNYASSLVNASMDLCRVALPGATGPPPATPNERKKENRKGKKNIKLTVHIAAILARQQYIMQLCRAL
MRYGAPTHRLEEYMMMTSNVLDIKAQFMYIPGCMFMSFDDQVTRTTEVKIVRVVQGLDLSRLAEVHNVYKHVVHD
IISVEKAIHELDQIMQRKPRYNRWLLILLTGLASVTVGPYSFSARPIDLPIIFMLGCLVGFMQYVVAPISATYSN
VLEVTVAILVSFISRAFGSIQHNGERVFCFSAMVQSSIAMILPGFAVLSSSLELQSHQMNAGSIRLVFTIIYSLF
LGYGVTVGTTIYGLMDKNATNEATCSHLPEVWGNEYIQHFPFVALFCLFAGLINQSKPRQLPVTIFMGMCGYIAN
YFSTKKLGANQVANTVGAFTIGLLANLYSRVWHGHAAAAIIPGIFTLVPSGLASSGSIISGLQYAEAVAAGDATN
SAASNSSLTALGYGMIQTAIGISVGLFISDLIVYPHGKKRSGIFSL*
Coding >Pro_DTO377G3_2|g8222.t1
ATGTCGGACGCACAGGAAAAGGCGCCGCCGATCCCTCCTCATCCTTCTGCGGGGACTGCCGAGGCAGACCGCGCT
GAAGGCAGTGATCACAATGTCGATTCCAACGCAGAAACCCTTCGTCCAGACGAGGCGCACCCGGAGCCCGAAACA
CTTTACCAGCGATGTCGGGCAGCAGGCCGGCGGATTCGCAATCGCGCTGTCATCATAGCCGAGATGCTCGGGCGA
CCACATGAAAAAGGGGATGGGTTGAATTCGCCAATGTTGCCAGACTACTATGAAACACTAGACGATATCCGAGCA
TACGAGGCCCGCCAGGCACTTGATGAGGAAGCGCGCCTCCCGGGAACAGACTATGATTCACAAGCGCGCCTCTTG
ATGGAACAAATGGGGTCCCAGTCCAGGCTACGGCGTCCACACCATATCAAAGAACCGTGTTCCGGGTCGACAACG
CCAGGAACGCCAGGGACTCCAGATGAGTCGGCAGGACCTGGCAGTCCACCCGGAGGGCTCTTATCACATCTTCTC
CGTGTATACGCCGACAACCTCCACGCAGCCCGGCTGAGTAGTATGTCTACAGCGTCAGAACCCAGCCCGGACGCA
GAACCCAAACCGGACGCAGAACCCATCGCATTACCCGACACAACGACGGGTGAAAAGAAAGACAAGTCGAAATGG
TACAACCACCCCAACAAACCCTCCCACAACTATGCTTCCTCCCTCGTCAATGCATCCATGGATTTGTGCCGGGTC
GCGCTCCCCGGAGCCACGGGTCCCCCTCCCGCGACTCCCAACGAACGAAAGAAGGAAAACCGCAAGGGAAAGAAA
AACATCAAGCTCACCGTCCACATTGCCGCCATTCTCGCCCGCCAGCAGTACATCATGCAGCTGTGCCGCGCTCTA
ATGAGATACGGCGCCCCAACCCACCGCCTGGAAGAGTACATGATGATGACATCCAACGTACTAGACATCAAAGCG
CAGTTTATGTACATCCCCGGATGCATGTTCATGTCCTTCGACGACCAGGTAACTCGCACCACCGAGGTAAAGATC
GTCCGCGTAGTGCAGGGGCTGGACCTCTCCCGTCTCGCGGAGGTACACAACGTCTACAAACACGTCGTCCACGAC
ATCATCAGCGTGGAAAAAGCCATCCACGAGCTAGACCAGATCATGCAGCGCAAACCGCGCTATAACCGCTGGCTC
CTCATCCTCCTGACCGGCTTAGCCAGCGTCACCGTCGGCCCATACTCCTTCAGCGCCCGCCCCATCGACCTCCCT
ATCATCTTCATGCTCGGCTGTCTAGTAGGCTTCATGCAGTACGTCGTCGCGCCCATCTCAGCGACCTACTCCAAC
GTGCTCGAAGTCACCGTCGCCATCCTCGTCTCGTTCATCTCGCGCGCGTTCGGCAGCATCCAGCATAACGGCGAG
CGCGTCTTCTGCTTCTCCGCCATGGTGCAGTCCTCCATAGCAATGATCCTCCCAGGCTTCGCCGTGTTAAGCAGC
AGTCTCGAGCTGCAGTCGCACCAGATGAACGCGGGCTCGATCCGCCTCGTCTTCACGATTATCTACTCGCTCTTC
CTCGGGTACGGCGTTACCGTCGGCACGACCATCTACGGGCTGATGGACAAGAACGCCACGAACGAGGCGACGTGC
TCGCATCTGCCGGAGGTCTGGGGCAACGAATACATCCAGCACTTCCCCTTCGTCGCGCTGTTCTGTCTCTTCGCG
GGGCTGATCAATCAGTCCAAGCCGAGACAGTTACCCGTGACTATCTTCATGGGTATGTGCGGCTACATCGCGAAT
TACTTTAGCACGAAGAAGCTCGGCGCGAACCAGGTTGCTAATACCGTGGGCGCGTTTACCATTGGGCTTCTGGCT
AATCTGTATAGTCGGGTGTGGCACGGCCATGCGGCTGCTGCTATTATTCCGGGTATATTCACCCTCGTCCCGTCG
GGTCTGGCGTCCAGTGGGTCGATTATCTCTGGCTTGCAGTATGCCGAAGCTGTTGCGGCGGGTGATGCTACTAAT
AGTGCGGCATCTAATAGCTCGCTTACCGCGCTGGGATACGGCATGATCCAGACGGCCATTGGTATTTCCGTCGGG
CTGTTCATCTCCGATCTGATTGTTTACCCGCATGGAAAGAAGCGGAGTGGAATTTTCAGTCTGTAG
Transcript >Pro_DTO377G3_2|g8222.t1
ATGTCGGACGCACAGGAAAAGGCGCCGCCGATCCCTCCTCATCCTTCTGCGGGGACTGCCGAGGCAGACCGCGCT
GAAGGCAGTGATCACAATGTCGATTCCAACGCAGAAACCCTTCGTCCAGACGAGGCGCACCCGGAGCCCGAAACA
CTTTACCAGCGATGTCGGGCAGCAGGCCGGCGGATTCGCAATCGCGCTGTCATCATAGCCGAGATGCTCGGGCGA
CCACATGAAAAAGGGGATGGGTTGAATTCGCCAATGTTGCCAGACTACTATGAAACACTAGACGATATCCGAGCA
TACGAGGCCCGCCAGGCACTTGATGAGGAAGCGCGCCTCCCGGGAACAGACTATGATTCACAAGCGCGCCTCTTG
ATGGAACAAATGGGGTCCCAGTCCAGGCTACGGCGTCCACACCATATCAAAGAACCGTGTTCCGGGTCGACAACG
CCAGGAACGCCAGGGACTCCAGATGAGTCGGCAGGACCTGGCAGTCCACCCGGAGGGCTCTTATCACATCTTCTC
CGTGTATACGCCGACAACCTCCACGCAGCCCGGCTGAGTAGTATGTCTACAGCGTCAGAACCCAGCCCGGACGCA
GAACCCAAACCGGACGCAGAACCCATCGCATTACCCGACACAACGACGGGTGAAAAGAAAGACAAGTCGAAATGG
TACAACCACCCCAACAAACCCTCCCACAACTATGCTTCCTCCCTCGTCAATGCATCCATGGATTTGTGCCGGGTC
GCGCTCCCCGGAGCCACGGGTCCCCCTCCCGCGACTCCCAACGAACGAAAGAAGGAAAACCGCAAGGGAAAGAAA
AACATCAAGCTCACCGTCCACATTGCCGCCATTCTCGCCCGCCAGCAGTACATCATGCAGCTGTGCCGCGCTCTA
ATGAGATACGGCGCCCCAACCCACCGCCTGGAAGAGTACATGATGATGACATCCAACGTACTAGACATCAAAGCG
CAGTTTATGTACATCCCCGGATGCATGTTCATGTCCTTCGACGACCAGGTAACTCGCACCACCGAGGTAAAGATC
GTCCGCGTAGTGCAGGGGCTGGACCTCTCCCGTCTCGCGGAGGTACACAACGTCTACAAACACGTCGTCCACGAC
ATCATCAGCGTGGAAAAAGCCATCCACGAGCTAGACCAGATCATGCAGCGCAAACCGCGCTATAACCGCTGGCTC
CTCATCCTCCTGACCGGCTTAGCCAGCGTCACCGTCGGCCCATACTCCTTCAGCGCCCGCCCCATCGACCTCCCT
ATCATCTTCATGCTCGGCTGTCTAGTAGGCTTCATGCAGTACGTCGTCGCGCCCATCTCAGCGACCTACTCCAAC
GTGCTCGAAGTCACCGTCGCCATCCTCGTCTCGTTCATCTCGCGCGCGTTCGGCAGCATCCAGCATAACGGCGAG
CGCGTCTTCTGCTTCTCCGCCATGGTGCAGTCCTCCATAGCAATGATCCTCCCAGGCTTCGCCGTGTTAAGCAGC
AGTCTCGAGCTGCAGTCGCACCAGATGAACGCGGGCTCGATCCGCCTCGTCTTCACGATTATCTACTCGCTCTTC
CTCGGGTACGGCGTTACCGTCGGCACGACCATCTACGGGCTGATGGACAAGAACGCCACGAACGAGGCGACGTGC
TCGCATCTGCCGGAGGTCTGGGGCAACGAATACATCCAGCACTTCCCCTTCGTCGCGCTGTTCTGTCTCTTCGCG
GGGCTGATCAATCAGTCCAAGCCGAGACAGTTACCCGTGACTATCTTCATGGGTATGTGCGGCTACATCGCGAAT
TACTTTAGCACGAAGAAGCTCGGCGCGAACCAGGTTGCTAATACCGTGGGCGCGTTTACCATTGGGCTTCTGGCT
AATCTGTATAGTCGGGTGTGGCACGGCCATGCGGCTGCTGCTATTATTCCGGGTATATTCACCCTCGTCCCGTCG
GGTCTGGCGTCCAGTGGGTCGATTATCTCTGGCTTGCAGTATGCCGAAGCTGTTGCGGCGGGTGATGCTACTAAT
AGTGCGGCATCTAATAGCTCGCTTACCGCGCTGGGATACGGCATGATCCAGACGGCCATTGGTATTTCCGTCGGG
CTGTTCATCTCCGATCTGATTGTTTACCCGCATGGAAAGAAGCGGAGTGGAATTTTCAGTCTGTAG
Gene >Pro_DTO377G3_2|g8222.t1
ATGTCGGACGCACAGGAAAAGGCGCCGCCGATCCCTCCTCATCCTTCTGCGGGGACTGCCGAGGCAGACCGCGCT
GAAGGCAGTGATCACAATGTCGATTCCAACGCAGAAACCCTTCGTCCAGACGAGGCGCACCCGGAGCCCGAAACA
CTTTACCAGCGATGTCGGGCAGCAGGCCGGCGGATTCGCAATCGCGCTGTCATCATAGCCGAGATGCTCGGGCGA
CCACATGAAAAAGGGGATGGGTTGAATTCGCCAATGTTGCCAGACTACTATGAAACACTAGACGATATCCGAGCA
TACGAGGCCCGCCAGGCACTTGATGAGGAAGCGCGCCTCCCGGGAACAGACTATGATTCACAAGCGCGCCTCTTG
ATGGAACAAATGGGGTCCCAGTCCAGGCTACGGCGTCCACACCATATCAAAGAACCGTGTTCCGGGTCGACAACG
CCAGGAACGCCAGGGACTCCAGATGAGTCGGCAGGACCTGGCAGTCCACCCGGAGGGCTCTTATCACATCTTCTC
CGTGTATACGCCGACAACCTCCACGCAGCCCGGCTGAGTAGTATGTCTACAGCGTCAGAACCCAGCCCGGACGCA
GAACCCAAACCGGACGCAGAACCCATCGCATTACCCGACACAACGACGGGTGAAAAGAAAGACAAGTCGAAATGG
TACAACCACCCCAACAAACCCTCCCACAACTATGCTTCCTCCCTCGTCAATGCATCCATGGATTTGTGCCGGGTC
GCGCTCCCCGGAGCCACGGGTCCCCCTCCCGCGACTCCCAACGAACGAAAGAAGGAAAACCGCAAGGGAAAGAAA
AACATCAAGCTCACCGTCCACATTGCCGCCATTCTCGCCCGCCAGCAGTACATCATGCAGCTGTGCCGCGCTCTA
ATGAGATACGGCGCCCCAACCCACCGCCTGGAAGAGTACATGATGATGACATCCAACGTACTAGACATCAAAGCG
CAGTTTATGTACATCCCCGGATGCATGTTCATGTCCTTCGACGACCAGGTAACTCGCACCACCGAGGTAAAGATC
GTCCGCGTAGTGCAGGGGCTGGACCTCTCCCGTCTCGCGGAGGTACACAACGTCTACAAACACGTCGTCCACGAC
ATCATCAGCGTGGAAAAAGCCATCCACGAGCTAGACCAGATCATGCAGCGCAAACCGCGCTATAACCGCTGGCTC
CTCATCCTCCTGACCGGCTTAGCCAGCGTCACCGTCGGCCCATACTCCTTCAGCGCCCGCCCCATCGACCTCCCT
ATCATCTTCATGCTCGGCTGTCTAGTAGGCTTCATGCAGTACGTCGTCGCGCCCATCTCAGCGACCTACTCCAAC
GTGCTCGAAGTCACCGTCGCCATCCTCGTCTCGTTCATCTCGCGCGCGTTCGGCAGCATCCAGCATAACGGCGAG
CGCGTCTTCTGCTTCTCCGCCATGGTGCAGTCCTCCATAGCAATGATCCTCCCAGGCTTCGCCGTGTTAAGCAGC
AGTCTCGAGCTGCAGTCGCACCAGATGAACGCGGGCTCGATCCGCCTCGTCTTCACGATTATCTACTCGCTCTTC
CTCGGGTACGGCGTTACCGTCGGCACGACCATCTACGGGCTGATGGACAAGAACGCCACGAACGAGGCGACGTGC
TCGCATCTGCCGGAGGTCTGGGGCAACGAATACATCCAGCACTTCCCCTTCGTCGCGCTGTTCTGTCTCTTCGCG
GGGCTGATCAATCAGTCCAAGCCGAGACAGTTACCCGTGACTATCTTCATGGGTATGTGCGGCTACATCGCGAAT
TACTTTAGCACGAAGAAGCTCGGCGCGAACCAGGTTGCTAATACCGTGGGCGCGTTTACCATTGGGCTTCTGGCT
AATCTGTATAGTCGGGTGTGGCACGGCCATGCGGCTGCTGCTATTATTCCGGGTATATTCACCCTCGTCCCGTCG
GGTCTGGCGTCCAGTGGGTCGATTATCTCTGGCTTGCAGTATGCCGAAGCTGTTGCGGCGGGTGATGCTACTAAT
AGTGCGGCATCTAATAGCTCGCTTACCGCGCTGGGATACGGCATGATCCAGACGGCCATTGGTATTTCCGTCGGG
CTGTTCATCTCCGATCTGATTGTTTACCCGCATGGAAAGAAGCGGAGTGGAATTTTCAGTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail