Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8219.t1
Gene name
Locationscaffold_30:148838..154232
Strand+
Gene length (bp)5394
Transcript length (bp)5331
Coding sequence length (bp)5331
Protein length (aa) 1777

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.6E-85 34 282
PF00698 Acyl_transf_1 Acyl transferase domain 2.2E-65 567 881
PF08659 KR KR domain 6.1E-61 1412 1602
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.5E-42 290 407
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 3.6E-13 411 529
PF00550 PP-binding Phosphopantetheine attachment site 1.9E-12 1704 1767
PF14765 PS-DH Polyketide synthase dehydratase 8.8E-11 926 1197

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8219.t1
MNSVSPSTYPSGKTSPAPAETPKTEYSEYEFSTDVAVVGMGCRVAGGNHSPELLWQSLLSQKSAVSEIPPMRWEP
YYRRDPRNAKELKKTTSRGYFLDRLEDFDCQFFGISPKEAEQMDPQQRVSLEVASEALEDAGIPAKSLSGSDTAV
FWGVNSDDYSKLVLEDLPNVEAWMGIGTAYCGVPNRISYHLNLMGPSSAVDAACASSLVAIHHGVQAIRLGESKV
AIVGGVNALCGPGLTRVLDKAGAISSDGSCKSFDDDAHGYARGEGAGALVLKSLHRALLDHDNVLAVIKGSAVAQ
DGKTNGIMAPNAKAQQLAARTALTVAGVDPSTVRYVEAHATSTPLGDPTEISAIAGVYGTDRHADDPCYIGSVKP
NIGHLEAGAGVMGFIKAILTIQKGILPPQANLTKLNSRIDWDKAGVKVVQEATPWPSSDPIRRAGVCSYGYGGTV
SHAVIEEFSHVLQPDPLDDGAVTGPGLLLLSGPQEKRLALQAKTLREWMAAEGKDHNLSEVLTTLATRRDHHDYR
AALVVDDHLDATQVLQALVNGVSHPFTTQSRVLGTEISKDVVWVFSGHGAQWPDMGKQLIHNPVFSAAIQPLDEL
IQAEIGLSPIELLRTGDFESSDRVQILTYLMQIGLSAVLQSNGITPQAVIGHSVGEIAASVVAGALSPAEGALIV
TRRALLYRQVMGKGGMILVNLPSGEAEQILGSRQDLVVAIDSSPSSCVVAGDKEIVAEAVEAFKARGVKTFTVKS
DIAFHSPTLNGLMDPLRDALGQTLAPTAPTIKLYSTALVDARGQDLRDVEYWTGNMVNRVRLTTAIQAAVEDGYR
LFLEVSAHPVVSHSINETLMDAGMENFAVIPTLLRQKPTEKHILHSIAQLHCRGAEVNWAAQMPGRWATGLPTTT
WMHKPIWRKVETAPLNTGLTHDVEKHTLLGQRIAVPGTDTFVYTTRLDNETKPFPGSHPLHGTEIVPAAGLINTF
LKGTGAQVLQNVVLRVPVAINAPRSVQVVVQQDQVKVVSRLIPSEPSLLDDDASWVTHTTAYWNRKVLGPVDRID
LAAVNARLVTKLPDNFSIDYLDKVGVSAMGFPWAVTEHYRNTKEMLARVDVNPAVLGDAPLPWDSSSWAPILDAA
TSIGSTVFQTAALRMPAHIERVEIFTSEDPPKISWLFVKEASDAVPTSHVSVLSKTGEVLAKFTAMRFSEIEGTP
GVSGSMESLVHQIAWPPATPAEEPLPIMTVIMISPDAATLAKYAATLPTQIQSFQFSGTEDFFSNALSLPLEKGT
VVAYIPGEVASLAEIPAASESFTWNLLELIKFIVNGSLPIKVFTLTANVGDGQTATALAQSPLFGLARIIASEHP
DLGSLIDIEEPIIPLSTMRYIHGAGIIRISDGIARTSRFRSLPRSKLRPVSDGPRLLPRAEGTYLITGGLGILGL
EVADFLVEKGARRLLLISRRALPPRRSWDQVSTDLQPAIAKIRLLESRGASVHVLPLDITKSDAVEQLSTALDRL
ALPAVQGVVHAAGVLDNELVMQTTRDAFNRVLAPKIAGALALHEVFPPKSVDFFIMFSSCGNLVGFTGQASYGSG
NAFLDTLATHRARLSDSAVSFQWTSWRGLGMGASTDFINAELESKGITDITRDEAFSAWQHLAKYDMDHGVVLRS
RAFEDGEPVPVSILNDIAVRRVGALSGNTPVVAGSNGSDAIPSSGPELKTYLDEKIRGCVAKVLQMTAEDVDSKA
ALADLGVDSVMTVTLRRQLQQTLKVAVPPTLTWSHPTVSHLVVWFAEKIGN*
Coding >Pro_DTO377G3_2|g8219.t1
ATGAATTCTGTTTCACCTTCTACATATCCCTCTGGGAAAACATCCCCAGCACCAGCTGAAACCCCTAAGACTGAA
TACAGTGAATATGAATTCTCCACCGACGTGGCCGTGGTGGGAATGGGCTGCCGTGTAGCGGGAGGCAACCACAGC
CCCGAGCTTCTCTGGCAATCGCTCCTCAGTCAGAAAAGTGCAGTGAGTGAGATCCCACCGATGCGCTGGGAGCCT
TACTATCGCCGGGATCCACGAAATGCAAAAGAGCTCAAGAAGACGACATCGCGTGGTTATTTCTTGGATCGCCTC
GAGGACTTTGACTGTCAGTTCTTCGGCATCTCCCCTAAGGAGGCCGAGCAGATGGATCCCCAACAGCGAGTCTCG
CTAGAGGTGGCCTCGGAAGCACTTGAGGATGCCGGCATTCCTGCCAAGAGCCTGTCTGGGAGCGACACGGCGGTC
TTCTGGGGTGTGAACTCGGACGACTACTCCAAGCTAGTGCTGGAGGATCTGCCGAATGTCGAGGCCTGGATGGGC
ATAGGCACCGCGTATTGTGGCGTGCCCAATCGCATTTCTTATCACCTCAACCTGATGGGACCCAGCAGTGCCGTG
GATGCGGCCTGTGCCTCGTCCCTCGTCGCCATCCATCATGGTGTTCAGGCCATCCGGTTGGGGGAATCAAAGGTG
GCTATTGTTGGAGGCGTCAATGCCCTCTGTGGACCGGGACTGACCCGCGTCCTCGACAAAGCCGGGGCCATCTCG
TCTGATGGATCTTGCAAGTCCTTCGATGATGACGCCCATGGGTACGCTAGAGGTGAAGGCGCCGGCGCCCTCGTA
CTCAAAAGTCTACACCGTGCATTGCTTGACCATGATAATGTCTTGGCCGTTATCAAGGGCAGTGCAGTAGCCCAG
GATGGGAAGACGAACGGCATCATGGCCCCCAATGCCAAAGCGCAACAGTTAGCAGCGCGGACTGCTCTTACCGTT
GCGGGTGTCGATCCTAGCACCGTGCGATATGTGGAAGCTCATGCCACGTCTACGCCCTTGGGCGACCCAACTGAA
ATATCAGCCATTGCAGGCGTCTACGGAACTGACCGCCACGCCGACGACCCGTGCTACATTGGGTCCGTCAAGCCG
AATATTGGTCACCTGGAGGCTGGTGCAGGAGTTATGGGCTTTATAAAAGCAATCCTGACTATCCAAAAGGGCATC
CTGCCGCCCCAGGCCAACTTGACAAAGCTCAATAGCCGAATTGACTGGGACAAGGCCGGCGTGAAGGTCGTTCAG
GAGGCCACTCCGTGGCCCTCCTCAGACCCCATTCGTCGAGCAGGTGTTTGCTCGTATGGCTACGGAGGAACCGTT
TCTCACGCAGTCATCGAGGAGTTCAGTCATGTCCTACAGCCAGATCCCCTGGATGATGGAGCAGTGACTGGACCA
GGCCTCTTGTTATTGTCGGGGCCCCAAGAAAAACGGCTAGCCCTGCAGGCCAAAACGTTGCGCGAGTGGATGGCC
GCTGAAGGAAAAGACCATAATCTGAGTGAAGTTCTCACGACTTTGGCTACGCGACGAGATCACCATGACTACCGA
GCAGCGCTTGTAGTTGACGACCATCTTGATGCTACCCAAGTCCTACAAGCATTGGTCAATGGAGTCAGCCATCCT
TTCACGACTCAGAGCCGTGTGTTGGGCACAGAAATCAGCAAGGACGTAGTCTGGGTATTTTCCGGGCACGGTGCG
CAGTGGCCAGACATGGGCAAGCAACTGATTCACAATCCTGTGTTCTCCGCAGCCATCCAGCCACTCGATGAGCTG
ATCCAAGCTGAGATTGGCCTATCACCCATCGAGCTGCTCCGGACAGGCGATTTTGAGTCGTCTGATCGGGTTCAA
ATCCTGACCTATCTCATGCAAATCGGACTTAGTGCCGTGCTGCAGAGCAATGGCATCACTCCACAGGCCGTGATC
GGCCACTCAGTGGGCGAAATTGCGGCCAGTGTTGTGGCCGGGGCTTTATCCCCAGCAGAGGGTGCGCTTATCGTG
ACTCGCAGAGCGTTATTATACCGACAGGTCATGGGCAAGGGCGGCATGATTCTTGTCAACCTTCCTAGTGGCGAG
GCTGAACAGATATTGGGCTCCCGACAGGACCTGGTTGTGGCCATCGATTCATCGCCTTCTTCCTGCGTGGTGGCT
GGAGACAAGGAGATAGTGGCCGAGGCAGTAGAAGCCTTCAAGGCACGAGGCGTGAAAACTTTCACCGTTAAGAGC
GACATTGCCTTCCATAGTCCAACTCTGAATGGCCTCATGGATCCCCTGCGAGATGCGCTCGGACAGACTCTGGCC
CCCACGGCTCCCACCATCAAGCTGTATTCTACCGCACTGGTCGATGCTCGCGGCCAGGACCTGCGCGACGTGGAA
TACTGGACCGGCAACATGGTCAACCGCGTGCGTCTCACCACGGCCATTCAGGCGGCCGTTGAGGACGGATATCGC
CTCTTCCTGGAAGTCTCAGCCCATCCAGTGGTGTCTCACTCCATCAATGAGACGCTTATGGACGCAGGCATGGAG
AATTTTGCGGTCATTCCGACTCTCCTTCGCCAAAAGCCGACTGAGAAGCATATCCTGCACAGTATCGCACAGCTT
CATTGTCGCGGCGCAGAAGTGAACTGGGCGGCGCAGATGCCTGGACGCTGGGCCACCGGACTGCCTACGACGACC
TGGATGCATAAGCCCATCTGGCGCAAGGTAGAGACGGCGCCCCTCAATACTGGCCTCACGCATGATGTCGAGAAG
CACACGCTTCTAGGACAGCGTATTGCAGTGCCTGGAACCGACACATTCGTCTATACTACCCGGCTGGACAACGAA
ACGAAGCCGTTCCCCGGCAGCCATCCTCTGCACGGCACCGAGATCGTTCCGGCAGCTGGTCTTATTAATACCTTC
TTGAAGGGCACCGGTGCCCAGGTACTCCAGAACGTGGTGCTCCGCGTTCCTGTCGCCATCAACGCGCCACGGTCC
GTCCAGGTCGTGGTGCAACAGGATCAGGTCAAGGTCGTTTCCCGCCTGATTCCGAGCGAGCCTTCGCTGTTGGAT
GACGATGCCTCCTGGGTCACTCACACCACTGCATATTGGAACCGGAAGGTTCTGGGTCCAGTAGATCGCATCGAC
CTCGCCGCCGTCAACGCGCGACTGGTCACCAAGCTTCCAGACAACTTTTCAATTGACTACTTGGACAAAGTAGGT
GTCTCAGCCATGGGATTCCCCTGGGCGGTAACAGAGCACTACCGCAATACCAAGGAGATGCTGGCGCGCGTTGAT
GTCAATCCTGCAGTCCTCGGGGATGCGCCCCTGCCCTGGGATTCTTCCTCCTGGGCCCCGATTCTCGACGCTGCC
ACCTCCATCGGCTCTACCGTCTTCCAAACAGCTGCACTGCGGATGCCGGCCCATATCGAGCGTGTGGAGATATTC
ACCTCGGAGGATCCGCCTAAGATCAGCTGGCTCTTCGTCAAGGAGGCCTCCGACGCAGTGCCCACCTCTCACGTT
AGCGTGCTGAGCAAGACGGGTGAGGTCCTCGCAAAGTTCACGGCCATGCGTTTCTCTGAGATTGAAGGCACACCC
GGCGTAAGTGGCAGCATGGAGAGTCTCGTGCATCAAATCGCCTGGCCACCGGCCACCCCGGCCGAAGAGCCTTTG
CCCATCATGACGGTGATTATGATCTCGCCCGATGCTGCCACCTTGGCCAAGTATGCCGCGACTCTGCCGACTCAA
ATTCAATCTTTCCAGTTCTCCGGCACAGAGGACTTCTTCAGCAACGCTCTATCCCTCCCACTCGAGAAGGGAACC
GTCGTGGCCTACATCCCCGGCGAGGTCGCCTCGCTGGCAGAGATTCCCGCTGCATCCGAGTCGTTCACTTGGAAC
CTGCTAGAACTTATCAAATTCATTGTCAATGGCTCACTGCCCATTAAAGTCTTCACACTCACTGCGAACGTGGGC
GATGGTCAAACTGCCACTGCCCTGGCCCAATCCCCGTTGTTTGGACTGGCGCGGATCATCGCTAGTGAGCATCCC
GATTTGGGATCCCTCATCGACATTGAAGAGCCCATAATCCCCCTCTCCACGATGAGATACATCCACGGCGCCGGC
ATCATCCGAATTAGCGATGGAATCGCCCGCACCTCGCGGTTCCGCAGCCTACCGCGCAGCAAGCTGCGCCCTGTC
AGTGACGGTCCTCGCCTGCTTCCTCGCGCCGAGGGCACGTATCTCATCACTGGTGGTCTCGGTATACTCGGGCTC
GAGGTGGCCGACTTCCTGGTCGAGAAAGGAGCCAGACGTCTACTGCTCATCTCGCGACGTGCTCTTCCGCCTCGC
CGCAGTTGGGACCAGGTCAGCACGGATCTCCAGCCTGCCATTGCCAAGATCCGCCTCCTGGAGAGTCGCGGTGCC
TCCGTCCATGTCCTCCCCCTAGACATCACCAAGTCGGATGCAGTGGAGCAGCTGTCAACGGCCCTAGACCGCCTC
GCCCTCCCTGCAGTCCAGGGTGTCGTCCATGCCGCCGGTGTCCTGGATAACGAGCTGGTAATGCAAACCACACGC
GACGCCTTCAACCGGGTTCTCGCGCCCAAAATTGCGGGTGCACTAGCCTTGCATGAAGTCTTCCCCCCGAAGAGT
GTTGATTTCTTCATCATGTTTTCCTCTTGCGGAAACCTAGTCGGATTTACTGGCCAAGCCTCTTACGGCAGCGGC
AACGCTTTCTTAGATACACTGGCTACGCACCGGGCGCGCCTGAGCGACTCGGCCGTGTCCTTCCAGTGGACGTCG
TGGCGAGGCCTAGGTATGGGCGCCAGCACAGACTTCATTAATGCGGAATTGGAATCCAAGGGAATCACAGATATC
ACGCGCGATGAGGCTTTTTCTGCCTGGCAGCACCTCGCCAAGTATGATATGGACCACGGAGTCGTCTTGCGAAGT
CGTGCCTTTGAGGACGGGGAGCCGGTGCCGGTGTCCATCCTCAATGATATTGCGGTGCGTCGCGTGGGCGCGTTG
TCTGGCAACACGCCGGTTGTTGCGGGTTCTAATGGCAGTGATGCGATTCCTTCATCCGGACCGGAACTCAAGACG
TACCTGGATGAGAAGATCCGGGGCTGTGTGGCCAAGGTGTTGCAGATGACAGCTGAGGATGTGGATTCCAAGGCA
GCCCTCGCTGATCTAGGTGTAGACTCGGTCATGACGGTCACTTTGCGTCGCCAGCTGCAGCAGACGCTCAAGGTT
GCGGTGCCTCCGACTTTGACGTGGAGTCACCCGACTGTCAGTCATCTGGTGGTGTGGTTTGCGGAGAAGATTGGC
AATTAA
Transcript >Pro_DTO377G3_2|g8219.t1
ATGAATTCTGTTTCACCTTCTACATATCCCTCTGGGAAAACATCCCCAGCACCAGCTGAAACCCCTAAGACTGAA
TACAGTGAATATGAATTCTCCACCGACGTGGCCGTGGTGGGAATGGGCTGCCGTGTAGCGGGAGGCAACCACAGC
CCCGAGCTTCTCTGGCAATCGCTCCTCAGTCAGAAAAGTGCAGTGAGTGAGATCCCACCGATGCGCTGGGAGCCT
TACTATCGCCGGGATCCACGAAATGCAAAAGAGCTCAAGAAGACGACATCGCGTGGTTATTTCTTGGATCGCCTC
GAGGACTTTGACTGTCAGTTCTTCGGCATCTCCCCTAAGGAGGCCGAGCAGATGGATCCCCAACAGCGAGTCTCG
CTAGAGGTGGCCTCGGAAGCACTTGAGGATGCCGGCATTCCTGCCAAGAGCCTGTCTGGGAGCGACACGGCGGTC
TTCTGGGGTGTGAACTCGGACGACTACTCCAAGCTAGTGCTGGAGGATCTGCCGAATGTCGAGGCCTGGATGGGC
ATAGGCACCGCGTATTGTGGCGTGCCCAATCGCATTTCTTATCACCTCAACCTGATGGGACCCAGCAGTGCCGTG
GATGCGGCCTGTGCCTCGTCCCTCGTCGCCATCCATCATGGTGTTCAGGCCATCCGGTTGGGGGAATCAAAGGTG
GCTATTGTTGGAGGCGTCAATGCCCTCTGTGGACCGGGACTGACCCGCGTCCTCGACAAAGCCGGGGCCATCTCG
TCTGATGGATCTTGCAAGTCCTTCGATGATGACGCCCATGGGTACGCTAGAGGTGAAGGCGCCGGCGCCCTCGTA
CTCAAAAGTCTACACCGTGCATTGCTTGACCATGATAATGTCTTGGCCGTTATCAAGGGCAGTGCAGTAGCCCAG
GATGGGAAGACGAACGGCATCATGGCCCCCAATGCCAAAGCGCAACAGTTAGCAGCGCGGACTGCTCTTACCGTT
GCGGGTGTCGATCCTAGCACCGTGCGATATGTGGAAGCTCATGCCACGTCTACGCCCTTGGGCGACCCAACTGAA
ATATCAGCCATTGCAGGCGTCTACGGAACTGACCGCCACGCCGACGACCCGTGCTACATTGGGTCCGTCAAGCCG
AATATTGGTCACCTGGAGGCTGGTGCAGGAGTTATGGGCTTTATAAAAGCAATCCTGACTATCCAAAAGGGCATC
CTGCCGCCCCAGGCCAACTTGACAAAGCTCAATAGCCGAATTGACTGGGACAAGGCCGGCGTGAAGGTCGTTCAG
GAGGCCACTCCGTGGCCCTCCTCAGACCCCATTCGTCGAGCAGGTGTTTGCTCGTATGGCTACGGAGGAACCGTT
TCTCACGCAGTCATCGAGGAGTTCAGTCATGTCCTACAGCCAGATCCCCTGGATGATGGAGCAGTGACTGGACCA
GGCCTCTTGTTATTGTCGGGGCCCCAAGAAAAACGGCTAGCCCTGCAGGCCAAAACGTTGCGCGAGTGGATGGCC
GCTGAAGGAAAAGACCATAATCTGAGTGAAGTTCTCACGACTTTGGCTACGCGACGAGATCACCATGACTACCGA
GCAGCGCTTGTAGTTGACGACCATCTTGATGCTACCCAAGTCCTACAAGCATTGGTCAATGGAGTCAGCCATCCT
TTCACGACTCAGAGCCGTGTGTTGGGCACAGAAATCAGCAAGGACGTAGTCTGGGTATTTTCCGGGCACGGTGCG
CAGTGGCCAGACATGGGCAAGCAACTGATTCACAATCCTGTGTTCTCCGCAGCCATCCAGCCACTCGATGAGCTG
ATCCAAGCTGAGATTGGCCTATCACCCATCGAGCTGCTCCGGACAGGCGATTTTGAGTCGTCTGATCGGGTTCAA
ATCCTGACCTATCTCATGCAAATCGGACTTAGTGCCGTGCTGCAGAGCAATGGCATCACTCCACAGGCCGTGATC
GGCCACTCAGTGGGCGAAATTGCGGCCAGTGTTGTGGCCGGGGCTTTATCCCCAGCAGAGGGTGCGCTTATCGTG
ACTCGCAGAGCGTTATTATACCGACAGGTCATGGGCAAGGGCGGCATGATTCTTGTCAACCTTCCTAGTGGCGAG
GCTGAACAGATATTGGGCTCCCGACAGGACCTGGTTGTGGCCATCGATTCATCGCCTTCTTCCTGCGTGGTGGCT
GGAGACAAGGAGATAGTGGCCGAGGCAGTAGAAGCCTTCAAGGCACGAGGCGTGAAAACTTTCACCGTTAAGAGC
GACATTGCCTTCCATAGTCCAACTCTGAATGGCCTCATGGATCCCCTGCGAGATGCGCTCGGACAGACTCTGGCC
CCCACGGCTCCCACCATCAAGCTGTATTCTACCGCACTGGTCGATGCTCGCGGCCAGGACCTGCGCGACGTGGAA
TACTGGACCGGCAACATGGTCAACCGCGTGCGTCTCACCACGGCCATTCAGGCGGCCGTTGAGGACGGATATCGC
CTCTTCCTGGAAGTCTCAGCCCATCCAGTGGTGTCTCACTCCATCAATGAGACGCTTATGGACGCAGGCATGGAG
AATTTTGCGGTCATTCCGACTCTCCTTCGCCAAAAGCCGACTGAGAAGCATATCCTGCACAGTATCGCACAGCTT
CATTGTCGCGGCGCAGAAGTGAACTGGGCGGCGCAGATGCCTGGACGCTGGGCCACCGGACTGCCTACGACGACC
TGGATGCATAAGCCCATCTGGCGCAAGGTAGAGACGGCGCCCCTCAATACTGGCCTCACGCATGATGTCGAGAAG
CACACGCTTCTAGGACAGCGTATTGCAGTGCCTGGAACCGACACATTCGTCTATACTACCCGGCTGGACAACGAA
ACGAAGCCGTTCCCCGGCAGCCATCCTCTGCACGGCACCGAGATCGTTCCGGCAGCTGGTCTTATTAATACCTTC
TTGAAGGGCACCGGTGCCCAGGTACTCCAGAACGTGGTGCTCCGCGTTCCTGTCGCCATCAACGCGCCACGGTCC
GTCCAGGTCGTGGTGCAACAGGATCAGGTCAAGGTCGTTTCCCGCCTGATTCCGAGCGAGCCTTCGCTGTTGGAT
GACGATGCCTCCTGGGTCACTCACACCACTGCATATTGGAACCGGAAGGTTCTGGGTCCAGTAGATCGCATCGAC
CTCGCCGCCGTCAACGCGCGACTGGTCACCAAGCTTCCAGACAACTTTTCAATTGACTACTTGGACAAAGTAGGT
GTCTCAGCCATGGGATTCCCCTGGGCGGTAACAGAGCACTACCGCAATACCAAGGAGATGCTGGCGCGCGTTGAT
GTCAATCCTGCAGTCCTCGGGGATGCGCCCCTGCCCTGGGATTCTTCCTCCTGGGCCCCGATTCTCGACGCTGCC
ACCTCCATCGGCTCTACCGTCTTCCAAACAGCTGCACTGCGGATGCCGGCCCATATCGAGCGTGTGGAGATATTC
ACCTCGGAGGATCCGCCTAAGATCAGCTGGCTCTTCGTCAAGGAGGCCTCCGACGCAGTGCCCACCTCTCACGTT
AGCGTGCTGAGCAAGACGGGTGAGGTCCTCGCAAAGTTCACGGCCATGCGTTTCTCTGAGATTGAAGGCACACCC
GGCGTAAGTGGCAGCATGGAGAGTCTCGTGCATCAAATCGCCTGGCCACCGGCCACCCCGGCCGAAGAGCCTTTG
CCCATCATGACGGTGATTATGATCTCGCCCGATGCTGCCACCTTGGCCAAGTATGCCGCGACTCTGCCGACTCAA
ATTCAATCTTTCCAGTTCTCCGGCACAGAGGACTTCTTCAGCAACGCTCTATCCCTCCCACTCGAGAAGGGAACC
GTCGTGGCCTACATCCCCGGCGAGGTCGCCTCGCTGGCAGAGATTCCCGCTGCATCCGAGTCGTTCACTTGGAAC
CTGCTAGAACTTATCAAATTCATTGTCAATGGCTCACTGCCCATTAAAGTCTTCACACTCACTGCGAACGTGGGC
GATGGTCAAACTGCCACTGCCCTGGCCCAATCCCCGTTGTTTGGACTGGCGCGGATCATCGCTAGTGAGCATCCC
GATTTGGGATCCCTCATCGACATTGAAGAGCCCATAATCCCCCTCTCCACGATGAGATACATCCACGGCGCCGGC
ATCATCCGAATTAGCGATGGAATCGCCCGCACCTCGCGGTTCCGCAGCCTACCGCGCAGCAAGCTGCGCCCTGTC
AGTGACGGTCCTCGCCTGCTTCCTCGCGCCGAGGGCACGTATCTCATCACTGGTGGTCTCGGTATACTCGGGCTC
GAGGTGGCCGACTTCCTGGTCGAGAAAGGAGCCAGACGTCTACTGCTCATCTCGCGACGTGCTCTTCCGCCTCGC
CGCAGTTGGGACCAGGTCAGCACGGATCTCCAGCCTGCCATTGCCAAGATCCGCCTCCTGGAGAGTCGCGGTGCC
TCCGTCCATGTCCTCCCCCTAGACATCACCAAGTCGGATGCAGTGGAGCAGCTGTCAACGGCCCTAGACCGCCTC
GCCCTCCCTGCAGTCCAGGGTGTCGTCCATGCCGCCGGTGTCCTGGATAACGAGCTGGTAATGCAAACCACACGC
GACGCCTTCAACCGGGTTCTCGCGCCCAAAATTGCGGGTGCACTAGCCTTGCATGAAGTCTTCCCCCCGAAGAGT
GTTGATTTCTTCATCATGTTTTCCTCTTGCGGAAACCTAGTCGGATTTACTGGCCAAGCCTCTTACGGCAGCGGC
AACGCTTTCTTAGATACACTGGCTACGCACCGGGCGCGCCTGAGCGACTCGGCCGTGTCCTTCCAGTGGACGTCG
TGGCGAGGCCTAGGTATGGGCGCCAGCACAGACTTCATTAATGCGGAATTGGAATCCAAGGGAATCACAGATATC
ACGCGCGATGAGGCTTTTTCTGCCTGGCAGCACCTCGCCAAGTATGATATGGACCACGGAGTCGTCTTGCGAAGT
CGTGCCTTTGAGGACGGGGAGCCGGTGCCGGTGTCCATCCTCAATGATATTGCGGTGCGTCGCGTGGGCGCGTTG
TCTGGCAACACGCCGGTTGTTGCGGGTTCTAATGGCAGTGATGCGATTCCTTCATCCGGACCGGAACTCAAGACG
TACCTGGATGAGAAGATCCGGGGCTGTGTGGCCAAGGTGTTGCAGATGACAGCTGAGGATGTGGATTCCAAGGCA
GCCCTCGCTGATCTAGGTGTAGACTCGGTCATGACGGTCACTTTGCGTCGCCAGCTGCAGCAGACGCTCAAGGTT
GCGGTGCCTCCGACTTTGACGTGGAGTCACCCGACTGTCAGTCATCTGGTGGTGTGGTTTGCGGAGAAGATTGGC
AATTAA
Gene >Pro_DTO377G3_2|g8219.t1
ATGAATTCTGTTTCACCTTCTACATATCCCTCTGGGAAAACATCCCCAGCACCAGCTGAAACCCCTAAGACTGAA
TACAGTGAATATGTATGTGGCCCCTCCCAACGTTGTCATTTCTGCCCAAGCGTACCTCGGACTGACAGTGAATAG
GAATTCTCCACCGACGTGGCCGTGGTGGGAATGGGCTGCCGTGTAGCGGGAGGCAACCACAGCCCCGAGCTTCTC
TGGCAATCGCTCCTCAGTCAGAAAAGTGCAGTGAGTGAGATCCCACCGATGCGCTGGGAGCCTTACTATCGCCGG
GATCCACGAAATGCAAAAGAGCTCAAGAAGACGACATCGCGTGGTTATTTCTTGGATCGCCTCGAGGACTTTGAC
TGTCAGTTCTTCGGCATCTCCCCTAAGGAGGCCGAGCAGATGGATCCCCAACAGCGAGTCTCGCTAGAGGTGGCC
TCGGAAGCACTTGAGGATGCCGGCATTCCTGCCAAGAGCCTGTCTGGGAGCGACACGGCGGTCTTCTGGGGTGTG
AACTCGGACGACTACTCCAAGCTAGTGCTGGAGGATCTGCCGAATGTCGAGGCCTGGATGGGCATAGGCACCGCG
TATTGTGGCGTGCCCAATCGCATTTCTTATCACCTCAACCTGATGGGACCCAGCAGTGCCGTGGATGCGGCCTGT
GCCTCGTCCCTCGTCGCCATCCATCATGGTGTTCAGGCCATCCGGTTGGGGGAATCAAAGGTGGCTATTGTTGGA
GGCGTCAATGCCCTCTGTGGACCGGGACTGACCCGCGTCCTCGACAAAGCCGGGGCCATCTCGTCTGATGGATCT
TGCAAGTCCTTCGATGATGACGCCCATGGGTACGCTAGAGGTGAAGGCGCCGGCGCCCTCGTACTCAAAAGTCTA
CACCGTGCATTGCTTGACCATGATAATGTCTTGGCCGTTATCAAGGGCAGTGCAGTAGCCCAGGATGGGAAGACG
AACGGCATCATGGCCCCCAATGCCAAAGCGCAACAGTTAGCAGCGCGGACTGCTCTTACCGTTGCGGGTGTCGAT
CCTAGCACCGTGCGATATGTGGAAGCTCATGCCACGTCTACGCCCTTGGGCGACCCAACTGAAATATCAGCCATT
GCAGGCGTCTACGGAACTGACCGCCACGCCGACGACCCGTGCTACATTGGGTCCGTCAAGCCGAATATTGGTCAC
CTGGAGGCTGGTGCAGGAGTTATGGGCTTTATAAAAGCAATCCTGACTATCCAAAAGGGCATCCTGCCGCCCCAG
GCCAACTTGACAAAGCTCAATAGCCGAATTGACTGGGACAAGGCCGGCGTGAAGGTCGTTCAGGAGGCCACTCCG
TGGCCCTCCTCAGACCCCATTCGTCGAGCAGGTGTTTGCTCGTATGGCTACGGAGGAACCGTTTCTCACGCAGTC
ATCGAGGAGTTCAGTCATGTCCTACAGCCAGATCCCCTGGATGATGGAGCAGTGACTGGACCAGGCCTCTTGTTA
TTGTCGGGGCCCCAAGAAAAACGGCTAGCCCTGCAGGCCAAAACGTTGCGCGAGTGGATGGCCGCTGAAGGAAAA
GACCATAATCTGAGTGAAGTTCTCACGACTTTGGCTACGCGACGAGATCACCATGACTACCGAGCAGCGCTTGTA
GTTGACGACCATCTTGATGCTACCCAAGTCCTACAAGCATTGGTCAATGGAGTCAGCCATCCTTTCACGACTCAG
AGCCGTGTGTTGGGCACAGAAATCAGCAAGGACGTAGTCTGGGTATTTTCCGGGCACGGTGCGCAGTGGCCAGAC
ATGGGCAAGCAACTGATTCACAATCCTGTGTTCTCCGCAGCCATCCAGCCACTCGATGAGCTGATCCAAGCTGAG
ATTGGCCTATCACCCATCGAGCTGCTCCGGACAGGCGATTTTGAGTCGTCTGATCGGGTTCAAATCCTGACCTAT
CTCATGCAAATCGGACTTAGTGCCGTGCTGCAGAGCAATGGCATCACTCCACAGGCCGTGATCGGCCACTCAGTG
GGCGAAATTGCGGCCAGTGTTGTGGCCGGGGCTTTATCCCCAGCAGAGGGTGCGCTTATCGTGACTCGCAGAGCG
TTATTATACCGACAGGTCATGGGCAAGGGCGGCATGATTCTTGTCAACCTTCCTAGTGGCGAGGCTGAACAGATA
TTGGGCTCCCGACAGGACCTGGTTGTGGCCATCGATTCATCGCCTTCTTCCTGCGTGGTGGCTGGAGACAAGGAG
ATAGTGGCCGAGGCAGTAGAAGCCTTCAAGGCACGAGGCGTGAAAACTTTCACCGTTAAGAGCGACATTGCCTTC
CATAGTCCAACTCTGAATGGCCTCATGGATCCCCTGCGAGATGCGCTCGGACAGACTCTGGCCCCCACGGCTCCC
ACCATCAAGCTGTATTCTACCGCACTGGTCGATGCTCGCGGCCAGGACCTGCGCGACGTGGAATACTGGACCGGC
AACATGGTCAACCGCGTGCGTCTCACCACGGCCATTCAGGCGGCCGTTGAGGACGGATATCGCCTCTTCCTGGAA
GTCTCAGCCCATCCAGTGGTGTCTCACTCCATCAATGAGACGCTTATGGACGCAGGCATGGAGAATTTTGCGGTC
ATTCCGACTCTCCTTCGCCAAAAGCCGACTGAGAAGCATATCCTGCACAGTATCGCACAGCTTCATTGTCGCGGC
GCAGAAGTGAACTGGGCGGCGCAGATGCCTGGACGCTGGGCCACCGGACTGCCTACGACGACCTGGATGCATAAG
CCCATCTGGCGCAAGGTAGAGACGGCGCCCCTCAATACTGGCCTCACGCATGATGTCGAGAAGCACACGCTTCTA
GGACAGCGTATTGCAGTGCCTGGAACCGACACATTCGTCTATACTACCCGGCTGGACAACGAAACGAAGCCGTTC
CCCGGCAGCCATCCTCTGCACGGCACCGAGATCGTTCCGGCAGCTGGTCTTATTAATACCTTCTTGAAGGGCACC
GGTGCCCAGGTACTCCAGAACGTGGTGCTCCGCGTTCCTGTCGCCATCAACGCGCCACGGTCCGTCCAGGTCGTG
GTGCAACAGGATCAGGTCAAGGTCGTTTCCCGCCTGATTCCGAGCGAGCCTTCGCTGTTGGATGACGATGCCTCC
TGGGTCACTCACACCACTGCATATTGGAACCGGAAGGTTCTGGGTCCAGTAGATCGCATCGACCTCGCCGCCGTC
AACGCGCGACTGGTCACCAAGCTTCCAGACAACTTTTCAATTGACTACTTGGACAAAGTAGGTGTCTCAGCCATG
GGATTCCCCTGGGCGGTAACAGAGCACTACCGCAATACCAAGGAGATGCTGGCGCGCGTTGATGTCAATCCTGCA
GTCCTCGGGGATGCGCCCCTGCCCTGGGATTCTTCCTCCTGGGCCCCGATTCTCGACGCTGCCACCTCCATCGGC
TCTACCGTCTTCCAAACAGCTGCACTGCGGATGCCGGCCCATATCGAGCGTGTGGAGATATTCACCTCGGAGGAT
CCGCCTAAGATCAGCTGGCTCTTCGTCAAGGAGGCCTCCGACGCAGTGCCCACCTCTCACGTTAGCGTGCTGAGC
AAGACGGGTGAGGTCCTCGCAAAGTTCACGGCCATGCGTTTCTCTGAGATTGAAGGCACACCCGGCGTAAGTGGC
AGCATGGAGAGTCTCGTGCATCAAATCGCCTGGCCACCGGCCACCCCGGCCGAAGAGCCTTTGCCCATCATGACG
GTGATTATGATCTCGCCCGATGCTGCCACCTTGGCCAAGTATGCCGCGACTCTGCCGACTCAAATTCAATCTTTC
CAGTTCTCCGGCACAGAGGACTTCTTCAGCAACGCTCTATCCCTCCCACTCGAGAAGGGAACCGTCGTGGCCTAC
ATCCCCGGCGAGGTCGCCTCGCTGGCAGAGATTCCCGCTGCATCCGAGTCGTTCACTTGGAACCTGCTAGAACTT
ATCAAATTCATTGTCAATGGCTCACTGCCCATTAAAGTCTTCACACTCACTGCGAACGTGGGCGATGGTCAAACT
GCCACTGCCCTGGCCCAATCCCCGTTGTTTGGACTGGCGCGGATCATCGCTAGTGAGCATCCCGATTTGGGATCC
CTCATCGACATTGAAGAGCCCATAATCCCCCTCTCCACGATGAGATACATCCACGGCGCCGGCATCATCCGAATT
AGCGATGGAATCGCCCGCACCTCGCGGTTCCGCAGCCTACCGCGCAGCAAGCTGCGCCCTGTCAGTGACGGTCCT
CGCCTGCTTCCTCGCGCCGAGGGCACGTATCTCATCACTGGTGGTCTCGGTATACTCGGGCTCGAGGTGGCCGAC
TTCCTGGTCGAGAAAGGAGCCAGACGTCTACTGCTCATCTCGCGACGTGCTCTTCCGCCTCGCCGCAGTTGGGAC
CAGGTCAGCACGGATCTCCAGCCTGCCATTGCCAAGATCCGCCTCCTGGAGAGTCGCGGTGCCTCCGTCCATGTC
CTCCCCCTAGACATCACCAAGTCGGATGCAGTGGAGCAGCTGTCAACGGCCCTAGACCGCCTCGCCCTCCCTGCA
GTCCAGGGTGTCGTCCATGCCGCCGGTGTCCTGGATAACGAGCTGGTAATGCAAACCACACGCGACGCCTTCAAC
CGGGTTCTCGCGCCCAAAATTGCGGGTGCACTAGCCTTGCATGAAGTCTTCCCCCCGAAGAGTGTTGATTTCTTC
ATCATGTTTTCCTCTTGCGGAAACCTAGTCGGATTTACTGGCCAAGCCTCTTACGGCAGCGGCAACGCTTTCTTA
GATACACTGGCTACGCACCGGGCGCGCCTGAGCGACTCGGCCGTGTCCTTCCAGTGGACGTCGTGGCGAGGCCTA
GGTATGGGCGCCAGCACAGACTTCATTAATGCGGAATTGGAATCCAAGGGAATCACAGATATCACGCGCGATGAG
GCTTTTTCTGCCTGGCAGCACCTCGCCAAGTATGATATGGACCACGGAGTCGTCTTGCGAAGTCGTGCCTTTGAG
GACGGGGAGCCGGTGCCGGTGTCCATCCTCAATGATATTGCGGTGCGTCGCGTGGGCGCGTTGTCTGGCAACACG
CCGGTTGTTGCGGGTTCTAATGGCAGTGATGCGATTCCTTCATCCGGACCGGAACTCAAGACGTACCTGGATGAG
AAGATCCGGGGCTGTGTGGCCAAGGTGTTGCAGATGACAGCTGAGGATGTGGATTCCAAGGCAGCCCTCGCTGAT
CTAGGTGTAGACTCGGTCATGACGGTCACTTTGCGTCGCCAGCTGCAGCAGACGCTCAAGGTTGCGGTGCCTCCG
ACTTTGACGTGGAGTCACCCGACTGTCAGTCATCTGGTGGTGTGGTTTGCGGAGAAGATTGGCAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail