Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8205.t1
Gene name
Locationscaffold_30:110662..114046
Strand-
Gene length (bp)3384
Transcript length (bp)3111
Coding sequence length (bp)3111
Protein length (aa) 1037

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 2.3E-30 676 812

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 91 113 22
2 134 156 22
3 171 193 22
4 200 218 18
5 233 255 22
6 653 670 17
7 685 707 22
8 719 741 22
9 756 773 17
10 794 816 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8205.t1
MPSGTPSSSRRSRPTLRQATFVLPKTGQRLKGLINLRNSTPDNNEERRGLLTNEIQHYEGYLDSLTRRIRDKWTQ
TNQFVRSEPGIGVLKYSLAYLVGSLATFIPAVSAMLGHQDGKHMVATVTVYFHPARSQGAMFKASICAFLAFCYS
TFLTITSMFVEMFFQDTLELPALGHAVVLIVFCGGGLGFVGWTKQRLGDPLVNVACSLTALSTITLLTKEGSVQS
GDLSLSKIFQVLKMVVMGVVAVMLVSFLVFPISARKKLRSNLVTVTDTLAIMMALITESFLSGSEEVLLSAEFVD
AEAKHRKAYSQLDRLVREAKLEHFVAGTEKEYRLEKNLVRWVQDITHNMGGLRNAASLQFSLIRETIAHDSVSPE
DQQGSSTHVDYFMTLERSWSFPEGSFLEPIVERPEEELSPVSSHQLGSTESTPRPTLLPADVFTVFISHLGPAMR
SLAFTLKEIFKEIPFGPAPDYKVSVNGRLRISLDRALDLYKESREKTLATLYQQKETMKLKSREAEADLEEVSAS
CGHFSFSLLEFGEQLREMLSILDELQLEVEERPNGRTWSWLKVWRWSRNAEAAKIASFDDETASNPTGTGQDSHK
HARHASDGLIAHDTLSVNVQTRKGPSANETTKQRLGYRLWKCLGFFRRDDTKYAIKVGAGAALYALPAFLPSTRP
FYGRWRGEWGLLSYMLVCSMTIGASNTTGYARFLGTCLGAVAAILAWNITAGNVFALAFLGWIMAVWTGYITIVR
GNGPMGRFIMLTYNLSVLYGYSLSRKQANLDEDEGGSHPIMAEIALHRVVAVLSGCIWGIIITRMIWPISARSRL
KESLSLLWLHLSLVWKRDPLSIMAKGKKSVLYMTPREKLEIERFLSRLESLQAAAGSEFELKSAFPEASYANIVR
RTRSMVNSFLTMNIELMKNNVATEGEISLLQYTKSERLQLSARVSHLLSVIASSMKLEYPMSDVLPSIEHARDRL
LARIYRYRLDHEASQQTTDEDCALLYAYILVTGQLSNEITEIIAEIGQLFGVLSEDVVQLS*
Coding >Pro_DTO377G3_2|g8205.t1
ATGCCATCTGGAACTCCCAGCAGCTCCCGACGTTCGCGCCCAACGCTCCGTCAGGCTACATTTGTCCTCCCAAAA
ACAGGCCAGCGCCTGAAAGGCCTCATCAACCTCCGAAACTCCACGCCTGACAACAATGAGGAAAGGCGCGGGCTC
CTCACAAACGAGATCCAACATTATGAGGGCTACCTCGACTCCCTCACGCGGCGTATACGTGATAAATGGACGCAG
ACAAATCAGTTTGTTAGGTCGGAACCGGGTATTGGAGTCTTGAAGTACAGTCTTGCGTATCTGGTCGGATCTCTG
GCAACTTTTATCCCCGCGGTCTCGGCCATGCTGGGCCATCAGGATGGAAAACACATGGTGGCTACGGTGACGGTC
TACTTTCACCCTGCCAGATCCCAGGGTGCGATGTTCAAGGCCTCGATCTGCGCTTTCCTGGCGTTCTGCTATTCT
ACCTTCTTGACTATTACCAGCATGTTCGTGGAGATGTTTTTCCAGGACACATTGGAATTGCCTGCCCTTGGTCAT
GCTGTGGTCCTGATAGTATTCTGTGGCGGTGGGCTTGGCTTTGTCGGTTGGACCAAGCAACGACTGGGAGATCCT
CTGGTGAATGTTGCCTGTTCACTCACGGCTCTGTCAACAATCACCCTTTTAACCAAGGAGGGTTCTGTACAAAGC
GGTGATTTGTCTCTTTCCAAGATCTTCCAAGTCCTAAAGATGGTCGTGATGGGCGTGGTGGCTGTCATGCTTGTA
TCCTTTTTGGTCTTCCCCATATCAGCGCGTAAAAAGCTGCGCTCAAACCTCGTCACCGTCACCGATACATTGGCT
ATCATGATGGCACTTATCACAGAAAGCTTCTTGAGCGGATCTGAGGAAGTGCTTCTCTCGGCTGAATTCGTTGAC
GCAGAGGCGAAGCACCGCAAGGCCTACAGCCAGCTCGACAGGCTCGTCCGAGAGGCTAAACTTGAGCACTTTGTG
GCAGGCACTGAAAAGGAGTACAGGCTCGAAAAGAATCTCGTCCGTTGGGTGCAAGATATTACCCATAACATGGGA
GGTTTGCGTAATGCAGCTTCTCTCCAATTCAGTTTGATTCGTGAGACTATTGCCCATGACTCTGTGTCTCCGGAA
GATCAGCAAGGTAGCTCGACTCATGTGGACTATTTCATGACCCTGGAGCGGTCCTGGTCATTTCCCGAAGGGTCC
TTTCTGGAGCCTATTGTTGAGCGACCAGAGGAGGAACTATCTCCAGTCAGCTCCCATCAACTTGGAAGTACTGAA
TCAACACCCAGACCCACGCTTCTTCCAGCAGATGTCTTCACTGTATTCATCTCTCATCTTGGCCCTGCAATGCGA
TCGTTGGCTTTCACATTGAAAGAAATCTTTAAGGAGATTCCATTTGGGCCTGCACCGGACTATAAGGTCTCAGTG
AATGGTCGACTGCGAATTAGTCTTGACCGAGCGCTTGATCTTTACAAAGAATCTCGCGAGAAGACACTCGCAACC
TTGTATCAACAAAAGGAAACCATGAAATTGAAGTCCCGTGAAGCTGAAGCCGATCTTGAGGAAGTGTCAGCTAGC
TGTGGCCATTTCAGCTTTTCGCTCCTCGAATTTGGGGAGCAGCTCCGAGAGATGCTTTCTATCTTGGATGAGTTG
CAGTTGGAAGTCGAAGAGCGGCCCAATGGGCGAACCTGGTCGTGGCTTAAAGTTTGGCGGTGGTCGAGAAACGCG
GAGGCCGCTAAAATAGCCTCATTTGACGATGAGACAGCTTCCAATCCAACCGGTACTGGGCAGGACTCCCATAAA
CATGCTAGGCATGCGTCAGACGGCTTGATTGCACATGATACACTCTCTGTCAATGTCCAAACACGAAAAGGCCCT
TCGGCGAATGAAACAACAAAGCAAAGGCTCGGTTACCGTTTATGGAAATGTCTTGGATTCTTCCGACGAGATGAT
ACGAAATACGCGATCAAGGTTGGGGCAGGAGCTGCACTCTATGCCCTACCTGCTTTTCTTCCTTCAACTCGCCCG
TTCTATGGGCGTTGGCGGGGAGAATGGGGTCTGCTGTCCTATATGCTGGTTTGCTCGATGACTATCGGGGCCTCG
AATACGACGGGGTATGCCCGGTTTCTCGGTACTTGTTTAGGGGCAGTCGCCGCTATCCTAGCATGGAATATCACC
GCTGGAAATGTATTTGCTCTTGCATTCTTGGGATGGATAATGGCTGTCTGGACTGGATACATCACTATTGTTCGT
GGGAATGGACCCATGGGCCGGTTTATCATGCTCACTTACAACCTCTCTGTGCTCTACGGCTATTCCCTTTCTCGG
AAACAAGCAAATCTGGACGAAGATGAAGGCGGTTCTCATCCAATCATGGCCGAGATTGCACTCCATCGAGTTGTT
GCTGTGTTGTCTGGGTGCATTTGGGGAATCATCATCACTCGAATGATTTGGCCCATCAGCGCAAGAAGTAGGCTC
AAGGAGAGCCTAAGTCTTCTCTGGCTGCACCTGAGCCTGGTCTGGAAACGCGATCCCCTATCCATCATGGCCAAA
GGCAAAAAGTCTGTTTTATACATGACGCCCCGAGAGAAGCTTGAGATTGAACGATTTTTGTCTCGGTTGGAATCT
CTCCAGGCTGCGGCAGGCTCCGAGTTTGAACTGAAGAGTGCATTCCCTGAAGCCTCATATGCCAACATTGTTCGC
CGTACACGCAGCATGGTGAATTCTTTCCTTACCATGAACATCGAGCTGATGAAGAATAATGTGGCCACTGAAGGT
GAAATCAGCCTTCTTCAATACACAAAATCAGAACGGCTGCAGCTATCTGCTCGGGTGAGCCATCTATTATCAGTG
ATTGCTTCTTCGATGAAACTCGAGTACCCTATGAGTGATGTCCTTCCTAGCATTGAGCATGCTAGAGACCGATTG
CTTGCTCGCATCTATCGCTATCGCCTGGATCATGAAGCATCTCAACAGACTACCGATGAGGACTGTGCTTTGCTT
TATGCATACATTTTGGTGACAGGCCAATTATCGAATGAAATCACGGAGATCATTGCAGAGATCGGACAACTGTTT
GGGGTATTAAGTGAAGATGTAGTGCAGCTATCTTGA
Transcript >Pro_DTO377G3_2|g8205.t1
ATGCCATCTGGAACTCCCAGCAGCTCCCGACGTTCGCGCCCAACGCTCCGTCAGGCTACATTTGTCCTCCCAAAA
ACAGGCCAGCGCCTGAAAGGCCTCATCAACCTCCGAAACTCCACGCCTGACAACAATGAGGAAAGGCGCGGGCTC
CTCACAAACGAGATCCAACATTATGAGGGCTACCTCGACTCCCTCACGCGGCGTATACGTGATAAATGGACGCAG
ACAAATCAGTTTGTTAGGTCGGAACCGGGTATTGGAGTCTTGAAGTACAGTCTTGCGTATCTGGTCGGATCTCTG
GCAACTTTTATCCCCGCGGTCTCGGCCATGCTGGGCCATCAGGATGGAAAACACATGGTGGCTACGGTGACGGTC
TACTTTCACCCTGCCAGATCCCAGGGTGCGATGTTCAAGGCCTCGATCTGCGCTTTCCTGGCGTTCTGCTATTCT
ACCTTCTTGACTATTACCAGCATGTTCGTGGAGATGTTTTTCCAGGACACATTGGAATTGCCTGCCCTTGGTCAT
GCTGTGGTCCTGATAGTATTCTGTGGCGGTGGGCTTGGCTTTGTCGGTTGGACCAAGCAACGACTGGGAGATCCT
CTGGTGAATGTTGCCTGTTCACTCACGGCTCTGTCAACAATCACCCTTTTAACCAAGGAGGGTTCTGTACAAAGC
GGTGATTTGTCTCTTTCCAAGATCTTCCAAGTCCTAAAGATGGTCGTGATGGGCGTGGTGGCTGTCATGCTTGTA
TCCTTTTTGGTCTTCCCCATATCAGCGCGTAAAAAGCTGCGCTCAAACCTCGTCACCGTCACCGATACATTGGCT
ATCATGATGGCACTTATCACAGAAAGCTTCTTGAGCGGATCTGAGGAAGTGCTTCTCTCGGCTGAATTCGTTGAC
GCAGAGGCGAAGCACCGCAAGGCCTACAGCCAGCTCGACAGGCTCGTCCGAGAGGCTAAACTTGAGCACTTTGTG
GCAGGCACTGAAAAGGAGTACAGGCTCGAAAAGAATCTCGTCCGTTGGGTGCAAGATATTACCCATAACATGGGA
GGTTTGCGTAATGCAGCTTCTCTCCAATTCAGTTTGATTCGTGAGACTATTGCCCATGACTCTGTGTCTCCGGAA
GATCAGCAAGGTAGCTCGACTCATGTGGACTATTTCATGACCCTGGAGCGGTCCTGGTCATTTCCCGAAGGGTCC
TTTCTGGAGCCTATTGTTGAGCGACCAGAGGAGGAACTATCTCCAGTCAGCTCCCATCAACTTGGAAGTACTGAA
TCAACACCCAGACCCACGCTTCTTCCAGCAGATGTCTTCACTGTATTCATCTCTCATCTTGGCCCTGCAATGCGA
TCGTTGGCTTTCACATTGAAAGAAATCTTTAAGGAGATTCCATTTGGGCCTGCACCGGACTATAAGGTCTCAGTG
AATGGTCGACTGCGAATTAGTCTTGACCGAGCGCTTGATCTTTACAAAGAATCTCGCGAGAAGACACTCGCAACC
TTGTATCAACAAAAGGAAACCATGAAATTGAAGTCCCGTGAAGCTGAAGCCGATCTTGAGGAAGTGTCAGCTAGC
TGTGGCCATTTCAGCTTTTCGCTCCTCGAATTTGGGGAGCAGCTCCGAGAGATGCTTTCTATCTTGGATGAGTTG
CAGTTGGAAGTCGAAGAGCGGCCCAATGGGCGAACCTGGTCGTGGCTTAAAGTTTGGCGGTGGTCGAGAAACGCG
GAGGCCGCTAAAATAGCCTCATTTGACGATGAGACAGCTTCCAATCCAACCGGTACTGGGCAGGACTCCCATAAA
CATGCTAGGCATGCGTCAGACGGCTTGATTGCACATGATACACTCTCTGTCAATGTCCAAACACGAAAAGGCCCT
TCGGCGAATGAAACAACAAAGCAAAGGCTCGGTTACCGTTTATGGAAATGTCTTGGATTCTTCCGACGAGATGAT
ACGAAATACGCGATCAAGGTTGGGGCAGGAGCTGCACTCTATGCCCTACCTGCTTTTCTTCCTTCAACTCGCCCG
TTCTATGGGCGTTGGCGGGGAGAATGGGGTCTGCTGTCCTATATGCTGGTTTGCTCGATGACTATCGGGGCCTCG
AATACGACGGGGTATGCCCGGTTTCTCGGTACTTGTTTAGGGGCAGTCGCCGCTATCCTAGCATGGAATATCACC
GCTGGAAATGTATTTGCTCTTGCATTCTTGGGATGGATAATGGCTGTCTGGACTGGATACATCACTATTGTTCGT
GGGAATGGACCCATGGGCCGGTTTATCATGCTCACTTACAACCTCTCTGTGCTCTACGGCTATTCCCTTTCTCGG
AAACAAGCAAATCTGGACGAAGATGAAGGCGGTTCTCATCCAATCATGGCCGAGATTGCACTCCATCGAGTTGTT
GCTGTGTTGTCTGGGTGCATTTGGGGAATCATCATCACTCGAATGATTTGGCCCATCAGCGCAAGAAGTAGGCTC
AAGGAGAGCCTAAGTCTTCTCTGGCTGCACCTGAGCCTGGTCTGGAAACGCGATCCCCTATCCATCATGGCCAAA
GGCAAAAAGTCTGTTTTATACATGACGCCCCGAGAGAAGCTTGAGATTGAACGATTTTTGTCTCGGTTGGAATCT
CTCCAGGCTGCGGCAGGCTCCGAGTTTGAACTGAAGAGTGCATTCCCTGAAGCCTCATATGCCAACATTGTTCGC
CGTACACGCAGCATGGTGAATTCTTTCCTTACCATGAACATCGAGCTGATGAAGAATAATGTGGCCACTGAAGGT
GAAATCAGCCTTCTTCAATACACAAAATCAGAACGGCTGCAGCTATCTGCTCGGGTGAGCCATCTATTATCAGTG
ATTGCTTCTTCGATGAAACTCGAGTACCCTATGAGTGATGTCCTTCCTAGCATTGAGCATGCTAGAGACCGATTG
CTTGCTCGCATCTATCGCTATCGCCTGGATCATGAAGCATCTCAACAGACTACCGATGAGGACTGTGCTTTGCTT
TATGCATACATTTTGGTGACAGGCCAATTATCGAATGAAATCACGGAGATCATTGCAGAGATCGGACAACTGTTT
GGGGTATTAAGTGAAGATGTAGTGCAGCTATCTTGA
Gene >Pro_DTO377G3_2|g8205.t1
ATGCCATCTGGAACTCCCAGCAGCTCCCGACGTTCGCGCCCAACGGTATGTGCTCGCAGTTTTTGACTTGGAAGA
TACTAATCGTCGGTGAAGCTCCGTCAGGCTACATTTGTCCTCCCAAAAACAGGCCAGCGCCTGAAAGGCCTCATC
AACCTCCGAAACTCCACGCCTGACAACAATGAGGAAAGGCGCGGGCTCCTCACAAACGAGATCCAACATTATGAG
GGCTACCTCGACTCCCTCACGCGGCGTATACGTGATAAATGGACGCAGACAAATCAGTTTGTTAGGTCGGAACCG
GGTATTGGAGTCTTGAAGTACAGTCTTGCGTATCTGGTCGGATCTCTGGCAACTTTTATCCCCGCGGTCTCGGCC
ATGCTGGGCCATCAGGATGGAAAACACATGGTGGCTACGGTGACGGTCTACTTTCACCCTGCCAGATCCCAGGGT
GCGATGTTCAAGGCCTCGATCTGCGCTTTCCTGGCGTTCTGCTATTCTACCTTCTTGACTATTACCAGCATGTTC
GTGGAGATGTTTTTCCAGGACACATTGGAATTGCCTGCCCTTGGTCATGCTGTGGTCCTGATAGTATTCTGTGGC
GGTGGGCTTGGCTTTGTCGGTTGGACCAAGCAACGACTGGGAGATCCTCTGGTGAATGTTGCCTGTTCACTCACG
GCTCTGTCAACAATCACCCTTTTAACCAAGGAGGGTTCTGTACAAAGCGGTGATTTGTCTCTTTCCAAGATCTTC
CAAGTCCTAAAGATGGTCGTGATGGGCGTGGTGGCTGTCATGCTTGTATCCTTTTTGGTCTTCCCCATATCAGCG
CGTAAAAAGCTGCGCTCAAACCTCGTCACCGTCACCGATACATTGGCTATCATGATGGCACTTATCACAGAAAGC
TTCTTGAGCGGATCTGAGGAAGTGCTTCTCTCGGCTGAATTCGTTGACGCAGAGGCGAAGCACCGCAAGGCCTAC
AGCCAGCTCGACAGGCTCGTCCGAGAGGCTAAACTTGAGCACTTTGTGGCAGGCACTGAAAAGGAGTACAGGCTC
GAAAAGAATCTCGTCCGTTGGGTGCAAGATATTACCCATAACATGGGAGGTTTGCGTAATGCAGCTTCTCTCCAA
TTCAGTTTGATTCGTGAGACTATTGCCCATGACTCTGTGTCTCCGGAAGATCAGCAAGGTAGCTCGACTCATGTG
GACTATTTCATGACCCTGGAGCGGTCCTGGTCATTTCCCGAAGGGTCCTTTCTGGAGCCTATTGTTGAGCGACCA
GAGGAGGAACTATCTCCAGTCAGCTCCCATCAACTTGGAAGTACTGAATCAACACCCAGACCCACGCTTCTTCCA
GCAGATGTCTTCACTGTATTCATCTCTCATCTTGGCCCTGCAATGGTAAGTTGGGACTCAAGAAGTATTTGATAT
AATTCAAGACTAACTAGAAGCAGCGATCGTTGGCTTTCACATTGAAAGAAATCTTTAAGGAGATTCCATTTGGGC
CTGCACCGGACTATAAGGTCTCAGTGAATGGTCGACTGCGAATTAGTCTTGACCGAGCGCTTGATCTTTACAAAG
AATCTCGCGAGAAGACACTCGCAACCTTGTATCAACAAAAGGAAACCATGAAATTGAAGTCCCGTGAAGCTGAAG
CCGATCTTGAGGAAGTGTCAGCTAGCTGTGGCCATTTCAGCTTTTCGCTCCTCGAATTTGGGGAGCAGCTCCGAG
AGATGCTTTCTATCTTGGATGAGTTGCAGTTGGAAGTCGAAGAGCGGCCCAATGGGCGAACCTGGTCGTGGCTTA
AAGTTTGGCGGTGGTCGAGAAACGCGGAGGCCGCTAAAATAGCCTCATTTGACGATGGTACGTATGCATACAAAT
CGTTGAGACATGGATTATATATTAATTCTCTGCAGAGACAGCTTCCAATCCAACCGGTACTGGGCAGGACTCCCA
TAAACATGCTAGGCATGCGTCAGACGGCTTGATTGCACATGATACACTCTCTGTCAATGTCCAAACACGAAAAGG
CCCTTCGGCGAATGAAACAACAAAGCAAAGGCTCGGTTACCGTTTATGGAAATGTCTTGGATTCTTCCGACGAGA
TGATACGAAATACGCGATCAAGGTTGGGGCAGGAGCTGCACTCTATGCCCTACCTGCTTTTCTTCCTTCAACTCG
CCCGTTCTATGGGCGTTGGCGGGGAGAATGGGGTCTGCTGTCCTATATGCTGGTTTGCTCGATGACTATCGGGGC
CTCGAATACGACGGGGTATGCCCGGTTTCTCGGTACTTGTTTAGGGGCAGTCGCCGCTATCCTAGCATGGAATAT
CACCGCTGGAAATGTATTTGCTCTTGCATTCTTGGGATGGATAATGGCTGTCTGGACTGGATACATCACTATTGT
TCGTGGGAATGGACCCATGGGCCGGTTTATCATGCTCACTTACAACCTCTCTGTGCTCTACGGCTATTCCCTTTC
TCGGAAACAAGCAAATCTGGACGAAGATGAAGGCGGTTCTCATCCAATCATGGCCGAGATTGCACTCCATCGAGT
TGTTGCTGTGTTGTCTGGGTGCATTTGGGGAATCATCATCACTCGAATGATTTGGCCCATCAGCGCAAGAAGTAG
GCTCAAGGAGAGCCTAAGTCTTCTCTGGCTGCACCTGAGCCTGGTCTGGAAACGCGATCCCCTATCCATCATGGC
CAAAGGCAAAAAGTCTGTTTTATACATGACGCCCCGAGAGAAGCTTGAGATTGAACGATTTTTGTCTCGGTTGGA
ATCTCTCCAGGCTGCGGCAGGCTCCGAGTTTGAACTGAAGAGTGCATTCCCTGAAGCCTCATATGCCAACATTGT
TCGCCGTACACGCAGCATGGTGAATTCTTTCCTTACCATGAACATCGAGCTGATGAAGAATAATGTGGCCACTGA
AGGTGAAATCAGCCTTCTTCAATACACAAAATCAGAACGGCTGCAGCTATCTGCTCGGGTGAGCCATCTATTATC
AGGTCAGTCCTCTTGTAACTTCCTTGTGCACTTGATGCGGCGCTGATTATCTTCCAGTGATTGCTTCTTCGATGA
AACTCGAGTACCCTATGAGTGATGTCCTTCCTAGCATTGAGCATGCTAGAGACCGATTGCTTGCTCGCATCTATC
GCTATCGCCTGGATCATGAAGCATCTCAACAGACTACCGATGAGGACTGTGCTTTGCTTTATGCATACAGTGAGT
ATCTCTTTGGTTTCTCGTCCCTTCCACCAGTTCAATACACTGACCCTTGTCCTTCTAGTTTTGGTGACAGGCCAA
TTATCGAATGAAATCACGGAGATCATTGCAGAGATCGGACAACTGTTTGGGGTATTAAGTGAAGATGTAGTGCAG
CTATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail