Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8203.t1
Gene name
Locationscaffold_30:105093..108221
Strand+
Gene length (bp)3128
Transcript length (bp)2922
Coding sequence length (bp)2922
Protein length (aa) 974

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06424 PRP1_N PRP1 splicing factor, N-terminal 8.8E-52 56 219
PF13428 TPR_14 Tetratricopeptide repeat 1.7E-05 643 684
PF14559 TPR_19 Tetratricopeptide repeat 1.2E-07 654 711
PF13432 TPR_16 Tetratricopeptide repeat 8.3E-03 646 706
PF13432 TPR_16 Tetratricopeptide repeat 9.4E-04 721 766

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0005634 nucleus Yes
GO:0006396 RNA processing No
GO:0043231 intracellular membrane-bounded organelle No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0044464 cell part No
GO:0043227 membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016071 mRNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0006397 mRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043226 organelle No
GO:0008380 RNA splicing No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044424 intracellular part No
GO:0016070 RNA metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8203.t1
MDFNVGGNFFCDKIAGAGNTISPSPPSPSAPSASSSLSCVVLDMASGRKDFLSQAAPENYVAGLGRGATGFTTRS
DLGPAREGPTPEQIQAALTKRAQLLGAAAPTAYGATSREKGGKDEDKEEEDERFQDPDNEVGLFAYGQFDQEDDE
ADRIYQEVDEKMDKRRRARREAREKAEQLEYERNNPKIQHQFADLKRTLASVSEEEWANLPEVGDLTGKNRRDKQ
NARQRHYAVPDSVIAGARDSAQYGTTIAEDGTETTVDEGENADSNMMNFADIGAARDKVLKVRLDQAASGTSTNI
DPKGYLTSLTQSEAKAGEVEVGDIKRVRTLLESVTKTNPKHAPGWIALARLEELAGRTVAARNLIAKGCELCPKS
EDAWLENIRLNEGHNAKIIAANAIKNNDRSTRLWTEAMRLETDTRAKKNVLRQAILHIPQSVQIWKEAVNLEDDP
ADARLLLAKAVEIIPLSVELWLALARLETPENAQKVLNAARKAVPTSYEIWIAAARLQEQMGTFARVNVMKRAIQ
SLVRENAMLKREEWITEAEKCESEGAVLTCGSIIQETLGWGLDEDDDRKDIWMDDAKASIARGNYETARAIYAYA
LRVFVNRRSIWLAAADLERNHGTKEALWQVLEKAVEACPQSEELWLLLAKEKWQSGDIDDARRVLGRAFNQNPNN
EDIWLAAVKLEADAKKPDQARELLATARREAGTDRVWTKSVAFERQLGNIDDALDLVNQGLQLFPKADKLWMIKG
QIYEAQNKLPQAREAYGTGTRACPKSVALWLLASRLEEKAGAVVRARSVLDRARLAVPKNAELWTESVRVERRAN
NISQARVLMARAIQDVPTSGLLWSESIWYLEPRAQRKARSLEAIKKVESDPILFITVARIFWGERRLEKAMTWFE
KAIVLDSDYGDGWAWYYKFLMQHGTEEKRADVVSKCMSMEPKHGEIWQSIAKDPANAYKTTEELLKLVANIIN*
Coding >Pro_DTO377G3_2|g8203.t1
ATGGACTTCAATGTGGGCGGGAACTTTTTTTGCGATAAGATTGCCGGCGCCGGGAATACCATTTCCCCGAGCCCG
CCTTCGCCTTCTGCGCCGTCGGCGTCGAGCTCTTTGAGTTGTGTTGTGCTCGATATGGCTTCTGGACGAAAGGAT
TTCCTAAGCCAGGCAGCGCCTGAAAACTATGTCGCTGGTCTAGGTCGTGGTGCGACAGGATTCACCACTCGCTCT
GATCTTGGCCCGGCGCGTGAGGGACCTACGCCCGAACAGATCCAAGCTGCTCTCACCAAGAGAGCTCAGCTTCTA
GGGGCTGCTGCACCCACTGCCTACGGCGCCACTTCACGCGAGAAAGGTGGAAAAGACGAGGATAAGGAGGAGGAA
GATGAGCGGTTCCAGGATCCCGACAACGAGGTCGGGCTGTTCGCGTACGGGCAGTTCGACCAAGAAGACGACGAA
GCAGACCGTATTTACCAGGAGGTAGACGAGAAAATGGACAAGCGCCGAAGAGCTCGCAGGGAAGCTCGAGAGAAA
GCCGAACAGCTAGAATACGAACGCAATAACCCGAAAATTCAACACCAATTTGCCGATCTGAAACGCACCCTCGCC
TCGGTATCCGAAGAAGAATGGGCCAACCTCCCGGAGGTTGGTGATTTGACGGGCAAGAATCGACGAGACAAACAG
AACGCCCGACAGCGGCACTACGCCGTTCCGGATAGTGTCATTGCTGGCGCGAGAGACTCAGCTCAGTATGGCACG
ACAATTGCCGAAGATGGCACGGAAACGACTGTCGACGAAGGAGAAAACGCCGACAGTAACATGATGAACTTCGCA
GATATCGGTGCGGCGCGCGATAAAGTGCTGAAGGTCCGACTTGACCAGGCTGCATCCGGAACCTCTACGAATATC
GACCCGAAGGGTTATCTCACCAGCTTGACACAATCAGAAGCCAAAGCTGGTGAAGTTGAGGTGGGCGATATCAAG
CGAGTTCGTACCTTGTTAGAGTCAGTTACCAAGACCAATCCTAAACATGCTCCCGGTTGGATTGCGCTAGCTCGT
CTAGAGGAGCTTGCTGGCCGGACTGTGGCAGCTAGGAACCTAATCGCGAAAGGGTGCGAGCTCTGCCCCAAAAGT
GAAGACGCATGGCTGGAAAACATTCGACTCAATGAAGGCCATAACGCAAAGATCATTGCAGCGAATGCAATTAAA
AACAATGACCGTTCCACAAGACTTTGGACCGAGGCCATGAGATTAGAAACGGACACCCGTGCCAAAAAGAATGTT
CTGCGACAAGCTATTCTACACATTCCCCAATCGGTGCAGATTTGGAAAGAAGCTGTCAACCTAGAAGACGATCCT
GCCGATGCGCGCTTGCTGCTGGCAAAGGCCGTTGAAATCATTCCTCTCTCAGTCGAGTTGTGGCTTGCCCTTGCT
CGTCTTGAAACCCCAGAAAATGCCCAAAAAGTCTTGAACGCTGCTCGCAAGGCCGTTCCTACCAGCTACGAAATC
TGGATTGCTGCAGCTCGACTCCAGGAACAGATGGGTACATTCGCTAGGGTCAATGTCATGAAGCGTGCTATTCAG
TCCCTGGTCCGAGAGAACGCTATGCTAAAGAGAGAGGAATGGATCACAGAAGCCGAGAAATGCGAAAGCGAAGGC
GCCGTTCTTACATGTGGTAGTATCATCCAAGAGACTCTCGGATGGGGCCTGGATGAGGATGATGACCGAAAAGAT
ATCTGGATGGACGACGCGAAGGCCAGTATTGCCCGTGGTAACTACGAAACTGCCCGGGCAATTTACGCTTACGCC
CTGCGAGTCTTTGTGAATCGTCGATCAATCTGGCTCGCAGCAGCGGACCTCGAGCGCAACCACGGCACCAAAGAA
GCTCTCTGGCAGGTCCTCGAGAAGGCAGTCGAAGCATGCCCTCAAAGCGAGGAGCTCTGGCTCCTCCTTGCCAAG
GAGAAATGGCAATCTGGAGATATTGACGATGCTCGACGAGTCTTGGGCCGTGCCTTCAACCAAAACCCTAACAAT
GAAGATATCTGGCTTGCTGCTGTTAAGCTAGAAGCGGACGCCAAAAAGCCAGACCAAGCCCGAGAGCTCCTGGCC
ACCGCCCGCCGTGAAGCTGGCACAGATCGCGTGTGGACCAAGAGCGTTGCTTTCGAGCGGCAGCTCGGCAACATC
GACGACGCTCTTGATCTAGTCAACCAAGGTCTGCAACTCTTCCCGAAGGCCGACAAGCTCTGGATGATCAAGGGC
CAAATCTATGAAGCGCAAAACAAGCTCCCGCAGGCGCGCGAGGCATACGGAACAGGCACCCGCGCCTGCCCCAAG
TCCGTTGCGCTGTGGCTACTTGCCTCGCGACTGGAAGAGAAAGCGGGCGCCGTGGTCCGAGCCCGATCCGTCCTC
GACCGGGCCCGCTTGGCCGTTCCCAAGAACGCAGAGCTTTGGACCGAAAGTGTGCGCGTTGAACGTCGCGCCAAC
AACATCTCCCAGGCCAGAGTCCTCATGGCGCGCGCGATCCAGGACGTCCCAACATCGGGGCTTCTGTGGAGCGAA
AGCATCTGGTATCTCGAGCCCCGCGCTCAGCGCAAGGCACGCAGTCTGGAGGCTATCAAGAAGGTCGAGAGCGAC
CCGATTCTGTTCATCACTGTTGCGCGTATCTTCTGGGGCGAGCGTCGGCTGGAGAAGGCCATGACCTGGTTTGAG
AAGGCGATCGTCTTGGATAGTGATTACGGTGATGGCTGGGCTTGGTATTACAAGTTCCTTATGCAGCATGGTACC
GAGGAAAAACGAGCAGACGTCGTGTCGAAGTGCATGTCAATGGAACCCAAGCACGGTGAGATCTGGCAGTCCATC
GCGAAGGACCCGGCCAATGCCTACAAGACTACCGAGGAGCTTCTGAAGCTTGTCGCGAATATCATCAACTAG
Transcript >Pro_DTO377G3_2|g8203.t1
ATGGACTTCAATGTGGGCGGGAACTTTTTTTGCGATAAGATTGCCGGCGCCGGGAATACCATTTCCCCGAGCCCG
CCTTCGCCTTCTGCGCCGTCGGCGTCGAGCTCTTTGAGTTGTGTTGTGCTCGATATGGCTTCTGGACGAAAGGAT
TTCCTAAGCCAGGCAGCGCCTGAAAACTATGTCGCTGGTCTAGGTCGTGGTGCGACAGGATTCACCACTCGCTCT
GATCTTGGCCCGGCGCGTGAGGGACCTACGCCCGAACAGATCCAAGCTGCTCTCACCAAGAGAGCTCAGCTTCTA
GGGGCTGCTGCACCCACTGCCTACGGCGCCACTTCACGCGAGAAAGGTGGAAAAGACGAGGATAAGGAGGAGGAA
GATGAGCGGTTCCAGGATCCCGACAACGAGGTCGGGCTGTTCGCGTACGGGCAGTTCGACCAAGAAGACGACGAA
GCAGACCGTATTTACCAGGAGGTAGACGAGAAAATGGACAAGCGCCGAAGAGCTCGCAGGGAAGCTCGAGAGAAA
GCCGAACAGCTAGAATACGAACGCAATAACCCGAAAATTCAACACCAATTTGCCGATCTGAAACGCACCCTCGCC
TCGGTATCCGAAGAAGAATGGGCCAACCTCCCGGAGGTTGGTGATTTGACGGGCAAGAATCGACGAGACAAACAG
AACGCCCGACAGCGGCACTACGCCGTTCCGGATAGTGTCATTGCTGGCGCGAGAGACTCAGCTCAGTATGGCACG
ACAATTGCCGAAGATGGCACGGAAACGACTGTCGACGAAGGAGAAAACGCCGACAGTAACATGATGAACTTCGCA
GATATCGGTGCGGCGCGCGATAAAGTGCTGAAGGTCCGACTTGACCAGGCTGCATCCGGAACCTCTACGAATATC
GACCCGAAGGGTTATCTCACCAGCTTGACACAATCAGAAGCCAAAGCTGGTGAAGTTGAGGTGGGCGATATCAAG
CGAGTTCGTACCTTGTTAGAGTCAGTTACCAAGACCAATCCTAAACATGCTCCCGGTTGGATTGCGCTAGCTCGT
CTAGAGGAGCTTGCTGGCCGGACTGTGGCAGCTAGGAACCTAATCGCGAAAGGGTGCGAGCTCTGCCCCAAAAGT
GAAGACGCATGGCTGGAAAACATTCGACTCAATGAAGGCCATAACGCAAAGATCATTGCAGCGAATGCAATTAAA
AACAATGACCGTTCCACAAGACTTTGGACCGAGGCCATGAGATTAGAAACGGACACCCGTGCCAAAAAGAATGTT
CTGCGACAAGCTATTCTACACATTCCCCAATCGGTGCAGATTTGGAAAGAAGCTGTCAACCTAGAAGACGATCCT
GCCGATGCGCGCTTGCTGCTGGCAAAGGCCGTTGAAATCATTCCTCTCTCAGTCGAGTTGTGGCTTGCCCTTGCT
CGTCTTGAAACCCCAGAAAATGCCCAAAAAGTCTTGAACGCTGCTCGCAAGGCCGTTCCTACCAGCTACGAAATC
TGGATTGCTGCAGCTCGACTCCAGGAACAGATGGGTACATTCGCTAGGGTCAATGTCATGAAGCGTGCTATTCAG
TCCCTGGTCCGAGAGAACGCTATGCTAAAGAGAGAGGAATGGATCACAGAAGCCGAGAAATGCGAAAGCGAAGGC
GCCGTTCTTACATGTGGTAGTATCATCCAAGAGACTCTCGGATGGGGCCTGGATGAGGATGATGACCGAAAAGAT
ATCTGGATGGACGACGCGAAGGCCAGTATTGCCCGTGGTAACTACGAAACTGCCCGGGCAATTTACGCTTACGCC
CTGCGAGTCTTTGTGAATCGTCGATCAATCTGGCTCGCAGCAGCGGACCTCGAGCGCAACCACGGCACCAAAGAA
GCTCTCTGGCAGGTCCTCGAGAAGGCAGTCGAAGCATGCCCTCAAAGCGAGGAGCTCTGGCTCCTCCTTGCCAAG
GAGAAATGGCAATCTGGAGATATTGACGATGCTCGACGAGTCTTGGGCCGTGCCTTCAACCAAAACCCTAACAAT
GAAGATATCTGGCTTGCTGCTGTTAAGCTAGAAGCGGACGCCAAAAAGCCAGACCAAGCCCGAGAGCTCCTGGCC
ACCGCCCGCCGTGAAGCTGGCACAGATCGCGTGTGGACCAAGAGCGTTGCTTTCGAGCGGCAGCTCGGCAACATC
GACGACGCTCTTGATCTAGTCAACCAAGGTCTGCAACTCTTCCCGAAGGCCGACAAGCTCTGGATGATCAAGGGC
CAAATCTATGAAGCGCAAAACAAGCTCCCGCAGGCGCGCGAGGCATACGGAACAGGCACCCGCGCCTGCCCCAAG
TCCGTTGCGCTGTGGCTACTTGCCTCGCGACTGGAAGAGAAAGCGGGCGCCGTGGTCCGAGCCCGATCCGTCCTC
GACCGGGCCCGCTTGGCCGTTCCCAAGAACGCAGAGCTTTGGACCGAAAGTGTGCGCGTTGAACGTCGCGCCAAC
AACATCTCCCAGGCCAGAGTCCTCATGGCGCGCGCGATCCAGGACGTCCCAACATCGGGGCTTCTGTGGAGCGAA
AGCATCTGGTATCTCGAGCCCCGCGCTCAGCGCAAGGCACGCAGTCTGGAGGCTATCAAGAAGGTCGAGAGCGAC
CCGATTCTGTTCATCACTGTTGCGCGTATCTTCTGGGGCGAGCGTCGGCTGGAGAAGGCCATGACCTGGTTTGAG
AAGGCGATCGTCTTGGATAGTGATTACGGTGATGGCTGGGCTTGGTATTACAAGTTCCTTATGCAGCATGGTACC
GAGGAAAAACGAGCAGACGTCGTGTCGAAGTGCATGTCAATGGAACCCAAGCACGGTGAGATCTGGCAGTCCATC
GCGAAGGACCCGGCCAATGCCTACAAGACTACCGAGGAGCTTCTGAAGCTTGTCGCGAATATCATCAACTAG
Gene >Pro_DTO377G3_2|g8203.t1
ATGGACTTCAATGTGGGCGGGAACTTTTTTTGCGATAAGATTGCCGGCGCCGGGAATACCATTTCCCCGAGCCCG
CCTTCGCCTTCTGCGCCGTCGGCGTCGAGCTCTTTGAGTTGTGTTGTGCTCGATATGGCTTCTGGACGAAAGGAT
TTCCTAAGCCAGGCAGCGCCTGAAAACTATGTCGCTGGTCTAGGTCGTGGTGCGACAGGATTCACCACTCGCTCT
GATCTTGGCCCGGCGCGTGAGGGACCTACGCCCGAACAGATCCAAGCTGCTCTCACCAAGAGAGCTCAGCTTCTA
GGGGCTGCTGCACCCACTGCCTACGGCGCCACTTCACGCGAGAAAGGTGGAAAAGACGAGGATAAGGAGGAGGAA
GATGAGCGGTTCCAGGATCCCGACAACGAGGTCGGGCTGTTCGCGTACGGGCAGTTCGACCAAGAAGACGACGAA
GCAGACCGTATTTACCAGGAGGTAGACGAGAAAATGGACAAGCGCCGAAGAGCTCGCAGGTTAGTCATATCCCTC
CCATTTCCCCCTCCCATTTTCACCTCCGAAACCATTTGTTTATCGGATTAGCTCTGGTCGTTTGGACAAAATACC
GACTTAAATCGCTCTCTACCTACAGGGAAGCTCGAGAGAAAGCCGAACAGCTAGAATACGAACGCAATAACCCGA
AAATTCAACACCAATTTGCCGATCTGAAACGCACCCTCGCCTCGGTATCCGAAGAAGAATGGGCCAACCTCCCGG
AGGTTGGTGATTTGACGGGCAAGAATCGACGAGACAAACAGAACGCCCGACAGCGGCACTACGCCGTTCCGGATA
GTGTCATTGCTGGCGCGAGAGACTCAGCTCAGTATGGCACGACAATTGCCGAAGATGGCACGGAAACGACTGTCG
ACGAAGGAGAAAACGCCGACAGTAACATGATGAACTTCGCAGATATCGGTGCGGCGCGCGATAAAGTGCTGAAGG
TCCGACTTGACCAGGCTGCATCCGGAACCTCTACGAATATCGACCCGAAGGGTTATCTCACCAGCTTGACACAAT
CAGAAGCCAAAGCTGGTGAAGTTGAGGTGGGCGATATCAAGCGAGTTCGTACCTTGTTAGAGTCAGTTACCAAGA
CCAATCCTAAACATGCTCCCGGTTGGATTGCGCTAGCTCGTCTAGAGGAGCTTGCTGGCCGGACTGTGGCAGCTA
GGAACCTAATCGCGAAAGGGTGCGAGCTCTGCCCCAAAAGTGAAGACGCATGGCTGGAAAACATTCGACTCAATG
AAGGCCATAACGCAAAGATCATTGCAGCGAATGCAATTAAAAACAATGACCGTTCCACAAGACTTTGGACCGAGG
CCATGAGATTAGAAACGGACACCCGTGCCAAAAAGAATGTTCTGCGACAAGCTATTCTACACATTCCCCAATCGG
TGCAGATTTGGAAAGAAGCTGTCAACCTAGAAGACGATCCTGCCGATGCGCGCTTGCTGCTGGCAAAGGCCGTTG
AAATCATTCCTCTCTCAGTCGAGTTGTGGCTTGCCCTTGCTCGTCTTGAAACCCCAGAAAATGCCCAAAAAGTCT
TGAACGCTGCTCGCAAGGCCGTTCCTACCAGCTACGAAATCTGGATTGCTGCAGCTCGACTCCAGGAACAGATGG
GTACATTCGCTAGGGTCAATGTCATGAAGCGTGCTATTCAGTCCCTGGTCCGAGAGAACGCTATGCTAAAGAGAG
AGGAATGGATCACAGAAGCCGAGAAATGCGAAAGCGAAGGCGCCGTTCTTACATGTGGTAGTATCATCCAAGAGA
CTCTCGGATGGGGCCTGGATGAGGATGATGACCGAAAAGATATCTGGATGGACGACGCGAAGGCCAGTATTGCCC
GTGGTAACTACGAAACTGCCCGGGCAATTTACGCTTACGCCCTGCGAGTCTTTGTGAATCGTCGATCAATCTGGC
TCGCAGCAGCGGACCTCGAGCGCAACCACGGCACCAAAGAAGCTCTCTGGCAGGTCCTCGAGAAGGCAGTCGAAG
CATGCCCTCAAAGCGAGGAGCTCTGGCTCCTCCTTGCCAAGGAGAAATGGCAATCTGGAGATATTGACGATGCTC
GACGAGTCTTGGGCCGTGCCTTCAACCAAAACCCTAACAATGAAGATATCTGGCTTGCTGCTGTTAAGCTAGAAG
CGGACGCCAAAAAGCCAGACCAAGCCCGAGAGCTCCTGGCCACCGCCCGCCGTGAAGCTGGCACAGATCGCGTGT
GGACCAAGAGCGTTGCTTTCGAGCGGCAGCTCGGCAACATCGACGACGCTCTTGATCTAGTCAACCAAGGTCTGC
AACTCTTCCCGAAGGCCGACAAGCTCTGGATGATCAAGGGCCAAATCTATGAAGCGCAAAACAAGCTCCCGCAGG
CGCGCGAGGCATACGGAACAGGCACCCGCGCCTGCCCCAAGTCCGTTGCGCTGTGGCTACTTGCCTCGCGACTGG
AAGAGAAAGCGGGCGCCGTGGTCCGAGCCCGATCCGTCCTCGACCGGGCCCGCTTGGCCGTTCCCAAGAACGCAG
AGCTTTGGACCGAAAGTGTGCGCGTTGAACGTCGCGCCAACAACATCTCCCAGGCCAGAGTCCTCATGGCGCGCG
CGATCCAGGACGTCCCAACATCGGGGCTTCTGTGGAGCGAAAGCATCTGGTATCTCGAGCCCCGCGCTCAGCGCA
AGGCACGCAGTCTGGAGGCTATCAAGAAGGTCGAGAGCGACCCGATTCTGTTCATCACTGTTGCGCGTATCTTCT
GGGGCGAGCGTCGGCTGGAGAAGGCCATGACCTGGTTTGAGAAGGCGATCGTCTTGGATAGTGATTACGGTGATG
GCTGGGCTTGGTATTACAAGTTCCTTATGCAGCATGGTACCGAGGTTAGTTTCTCTCTCCCCTTTTCATTCATTC
ACTCTTTGGGCTCTGTGTTATCGTTATCAGTGGAATATCCAGCTGACATCTAGTTACAGGAAAAACGAGCAGACG
TCGTGTCGAAGTGCATGTCAATGGAACCCAAGCACGGTGAGATCTGGCAGTCCATCGCGAAGGACCCGGCCAATG
CCTACAAGACTACCGAGGAGCTTCTGAAGCTTGTCGCGAATATCATCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail