Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8200.t1
Gene name
Locationscaffold_30:97880..100897
Strand-
Gene length (bp)3017
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.3E-15 108 159
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.9E-15 191 248

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 43.82 26.20 61.44
5d_25C Five days - 25 degrees Celsius 49.05 29.48 68.63
7d_25C Seven days - 25 degrees Celsius 55.35 33.62 77.09
10d_25C Ten days - 25 degrees Celsius 84.08 51.34 116.82
7d_15C Seven days - 15 degrees Celsius 53.77 32.62 74.93
7d_30C Seven days - 30 degrees Celsius 55.71 33.86 77.56

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.701242 no
3d_25C 7d_25C 0.338937 no
3d_25C 7d_15C 0.417860 no
3d_25C 7d_30C 0.321716 no
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.670432 no
5d_25C 7d_15C 0.761103 no
5d_25C 7d_30C 0.650749 no
5d_25C 10d_25C 0.007091 yes
7d_25C 7d_15C 0.931822 no
7d_25C 7d_30C 0.986483 no
7d_25C 10d_25C 0.045756 yes
7d_15C 7d_30C 0.915574 no
7d_15C 10d_25C 0.029770 yes
7d_30C 10d_25C 0.050137 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8200.t1
MADPEDGDDLFADLYDADDSTNRTTAVEAPKPTDLGATNLATTGDSAQDFRPDPVGTYESHPSQPSEFDPGYHNG
SGNAYGAPATSQAPPPAETESHGTGIKEDGKMFIGGLNWETTDESLRDYFSQFGEVQECTVMRDSATGRSRGFGF
LTFRDAKTVNTVMVKEHYLDGKIIDPKRAIPRDEQEKTSKIFVGGVSQEATEQDFKQFFMQFGRVVDATLMMDKD
TGRPRGFGFVTFDGDAAVEKALSRPLEILGKPIEVKKAQPRGNLRDNNDQRGGHRNGGYRDQNQNDGGQQQAPQQ
GQGSSMTPQMMAQYWQRMQQYFTMMQHQMAGQGGMPGMNMGAMNMNPAMMAQMQQVQQMQMRQQQQQQMGAQQGA
MSPGPQSPGSQQAMPNMMNPAMMQPNQAVAAGGPASDSASPVPNAVAMAANYNNGTPNSARGQTGPGYNATEQIA
FEQQKYEQQQISRSMDPRGFSPYQQQGGPTSWEGMYDEVPQPHVPTGPAGMRRMGSSGSGTTPQPQSTAPANAPT
GPRNAGKPGANYRGGGRGGHRTFHPYQR*
Coding >Pro_DTO377G3_2|g8200.t1
ATGGCTGACCCTGAGGATGGAGATGATCTCTTCGCTGATCTCTACGACGCTGATGATTCCACCAATCGTACCACT
GCAGTCGAGGCGCCCAAGCCTACTGATCTAGGCGCGACCAACTTGGCTACCACTGGAGACTCTGCTCAGGATTTC
AGACCTGACCCTGTTGGCACATACGAATCGCACCCTAGTCAGCCTTCGGAATTTGACCCGGGTTACCACAATGGT
TCTGGAAATGCTTATGGTGCCCCTGCCACTAGCCAGGCACCCCCTCCTGCCGAGACCGAGTCTCACGGAACAGGA
ATTAAAGAAGACGGAAAGATGTTCATCGGTGGTCTGAACTGGGAAACTACAGACGAATCCCTCCGTGACTACTTC
TCTCAGTTCGGTGAGGTGCAAGAGTGCACTGTCATGCGAGATAGCGCCACTGGACGCTCTCGTGGCTTTGGATTT
TTGACTTTCCGCGACGCTAAGACTGTCAATACCGTGATGGTGAAGGAGCATTATCTGGATGGAAAGATTATCGAT
CCTAAGCGTGCTATTCCTCGTGACGAACAGGAGAAGACTTCCAAGATTTTCGTTGGTGGTGTTAGCCAGGAGGCT
ACCGAGCAGGACTTTAAGCAATTCTTCATGCAGTTTGGCCGTGTTGTGGATGCCACTCTTATGATGGACAAGGAC
ACCGGACGGCCCCGTGGATTCGGTTTCGTCACCTTCGACGGCGATGCTGCCGTTGAGAAGGCTCTCTCCCGTCCT
CTTGAGATTCTGGGCAAGCCAATTGAGGTCAAGAAGGCCCAGCCCCGTGGCAACCTGCGTGACAACAATGATCAA
CGCGGAGGCCACCGCAACGGAGGATACCGCGACCAAAACCAGAACGATGGAGGTCAGCAGCAAGCCCCTCAGCAG
GGACAGGGTAGTTCGATGACTCCTCAAATGATGGCCCAATACTGGCAACGCATGCAGCAGTACTTTACCATGATG
CAGCATCAGATGGCCGGTCAGGGAGGAATGCCTGGTATGAACATGGGCGCTATGAACATGAACCCCGCTATGATG
GCCCAGATGCAACAAGTGCAGCAGATGCAGATGCGTCAGCAGCAGCAACAGCAAATGGGTGCCCAGCAAGGTGCT
ATGAGCCCCGGCCCTCAGAGTCCTGGCTCCCAGCAGGCTATGCCCAACATGATGAACCCGGCCATGATGCAGCCC
AACCAAGCCGTTGCTGCCGGCGGTCCTGCCAGCGATTCCGCTAGCCCTGTCCCCAATGCCGTTGCCATGGCCGCT
AACTACAACAACGGAACTCCAAACTCAGCCAGAGGACAGACTGGACCTGGATACAACGCGACCGAGCAGATCGCC
TTCGAGCAGCAGAAGTATGAACAGCAGCAGATCAGCCGCTCGATGGATCCTCGCGGCTTCTCGCCTTACCAGCAG
CAGGGTGGCCCAACCTCGTGGGAGGGTATGTACGATGAAGTTCCTCAACCTCACGTTCCGACTGGACCAGCAGGT
ATGAGACGCATGGGAAGTTCGGGTAGTGGAACCACTCCTCAGCCCCAGAGCACTGCTCCCGCCAATGCTCCCACT
GGACCCCGCAACGCCGGCAAGCCTGGTGCGAACTACCGTGGCGGCGGCCGAGGTGGACACCGTACCTTCCACCCT
TACCAGCGCTAA
Transcript >Pro_DTO377G3_2|g8200.t1
ATGGCTGACCCTGAGGATGGAGATGATCTCTTCGCTGATCTCTACGACGCTGATGATTCCACCAATCGTACCACT
GCAGTCGAGGCGCCCAAGCCTACTGATCTAGGCGCGACCAACTTGGCTACCACTGGAGACTCTGCTCAGGATTTC
AGACCTGACCCTGTTGGCACATACGAATCGCACCCTAGTCAGCCTTCGGAATTTGACCCGGGTTACCACAATGGT
TCTGGAAATGCTTATGGTGCCCCTGCCACTAGCCAGGCACCCCCTCCTGCCGAGACCGAGTCTCACGGAACAGGA
ATTAAAGAAGACGGAAAGATGTTCATCGGTGGTCTGAACTGGGAAACTACAGACGAATCCCTCCGTGACTACTTC
TCTCAGTTCGGTGAGGTGCAAGAGTGCACTGTCATGCGAGATAGCGCCACTGGACGCTCTCGTGGCTTTGGATTT
TTGACTTTCCGCGACGCTAAGACTGTCAATACCGTGATGGTGAAGGAGCATTATCTGGATGGAAAGATTATCGAT
CCTAAGCGTGCTATTCCTCGTGACGAACAGGAGAAGACTTCCAAGATTTTCGTTGGTGGTGTTAGCCAGGAGGCT
ACCGAGCAGGACTTTAAGCAATTCTTCATGCAGTTTGGCCGTGTTGTGGATGCCACTCTTATGATGGACAAGGAC
ACCGGACGGCCCCGTGGATTCGGTTTCGTCACCTTCGACGGCGATGCTGCCGTTGAGAAGGCTCTCTCCCGTCCT
CTTGAGATTCTGGGCAAGCCAATTGAGGTCAAGAAGGCCCAGCCCCGTGGCAACCTGCGTGACAACAATGATCAA
CGCGGAGGCCACCGCAACGGAGGATACCGCGACCAAAACCAGAACGATGGAGGTCAGCAGCAAGCCCCTCAGCAG
GGACAGGGTAGTTCGATGACTCCTCAAATGATGGCCCAATACTGGCAACGCATGCAGCAGTACTTTACCATGATG
CAGCATCAGATGGCCGGTCAGGGAGGAATGCCTGGTATGAACATGGGCGCTATGAACATGAACCCCGCTATGATG
GCCCAGATGCAACAAGTGCAGCAGATGCAGATGCGTCAGCAGCAGCAACAGCAAATGGGTGCCCAGCAAGGTGCT
ATGAGCCCCGGCCCTCAGAGTCCTGGCTCCCAGCAGGCTATGCCCAACATGATGAACCCGGCCATGATGCAGCCC
AACCAAGCCGTTGCTGCCGGCGGTCCTGCCAGCGATTCCGCTAGCCCTGTCCCCAATGCCGTTGCCATGGCCGCT
AACTACAACAACGGAACTCCAAACTCAGCCAGAGGACAGACTGGACCTGGATACAACGCGACCGAGCAGATCGCC
TTCGAGCAGCAGAAGTATGAACAGCAGCAGATCAGCCGCTCGATGGATCCTCGCGGCTTCTCGCCTTACCAGCAG
CAGGGTGGCCCAACCTCGTGGGAGGGTATGTACGATGAAGTTCCTCAACCTCACGTTCCGACTGGACCAGCAGGT
ATGAGACGCATGGGAAGTTCGGGTAGTGGAACCACTCCTCAGCCCCAGAGCACTGCTCCCGCCAATGCTCCCACT
GGACCCCGCAACGCCGGCAAGCCTGGTGCGAACTACCGTGGCGGCGGCCGAGGTGGACACCGTACCTTCCACCCT
TACCAGCGCTAA
Gene >Pro_DTO377G3_2|g8200.t1
ATGGCTGACCCTGAGGATGGAGATGATCTCTTCGCTGATCTGTATGTTTTCTACTTCACTTTACCTTGAATAATG
AAATTCTAATCAGGCTTCTTTCATAGCTACGACGCTGATGATTCCACCAATCGTACCACTGCAGTCGAGGCGCCC
AAGCCTACTGATCTAGGCGCGACCAACTTGGCTACCACTGGAGACTCTGCTCAGGATTTCAGACCTGACCCTGTT
GGCACATACGAATCGCACCCTAGTCAGCCTTCGGAATTTGACCCGGGTTACCACAATGGTTCTGGAAATGCTTAT
GGTGCCCCTGCCACTAGCCAGGCACCCCCTCCTGCCGAGACCGAGTCTCACGGAACAGGAATTAAAGAAGACGGG
TAAGTCCACTAATTGCGTTTCTTTTGCATTTTCATGTTCGAACTCTACCCCAACTGCATGTATCCGTCTGGTTTT
GGGCTTTACCTCGTCAGTACAGGCCTGGGTCGCGCAATTGCTATTCATGGGTTAAGTCTGGGTGCCGGAAGGAGT
CTCCTATCTGCGGGTTAAAATCTCTCTGGGATGTGGGCTGTTGGCTGTTTGAGGAAAAGTCCACCGGTTGGTTGA
CGGCGCACGCGTTTTCAACCTTGGAAATGAGGGAGAACAAACTGCGGGCTCGGCGACCATCAAGACGTCTGTTCG
AGGGACCCATTCGCACAACCACCAACGTCTACCAAGGGTGATCTACAGATCATATTGGGAGTGCTCCAGCATTTG
CTACACGGAATCAAGCAGAGGCTCGAAAGAAATATCGCCTGGGACCCTTGATCAAGACAATTTCTTGCGTGAATC
AACCACACCCCAACCATGGACCTTTGTCACAAACGATTCATATATAGTACAGCCGATACTATATAGTTTCCTGTC
GATATACCTTGATAGGGCAGAGCAAGAAGTAGCTATCTAGCTTGAGACTCTGTGTTAGACAAGGCAAAGGTTTTC
ACGAGTCAGACAGACAGACAGTGACAATTCACTTTTTACGACTGAAATACTTGCACCTCCTCGCTTCTCATCTCG
CCTGTCTCCGGCTTGAGAAATCCAGAAAGAGAAGGACATGAATTCTGCATCCAGGCCCATGTAAACCAGTGGGCT
TGACGTTAAATCCCTGTCATGAACATCAAAATTGCTCAAGACCATACAAGTATACATTGACAGTGACTACGAGGC
ACAAAGATCACGTACCGGCCAAGCACGTGCGCTGCTTGTTCCAGGGCCGTTGTGCCCAGAATAGCGAGGCTTTTC
GTGCACTCGAATAGCCCATGAATAGCACTACCTCCCCTTACCTTTTCACGTTCATTTACTTCCTTTACCCTACCA
CATTACATCCTGTCGTTCGCCGATCATAATTGGTCCGGACATTTGCTCTTTCATTTTCATGAACAGTCGCTAACC
GAGGACAACACGTGGTTAGAAAGATGTTCATCGGTGGTCTGAACTGGGAAACTACAGACGGTAAATCTATCTTTC
TTACACGGTAAATGTATCATATAGCTGACATATCTTGAACTTCATTTAGAATCCCTCCGTGACTACTTCTCTCAG
TTCGGTGAGGTGCAAGAGTGCACTGTCATGCGAGATAGCGCCACTGGACGCTCTCGTGGCTTTGGATTTTTGACT
TTCCGCGACGCTAAGACTGTCAATACCGTGATGGTGAAGGAGCATTATCTGGATGGAAAGATTGTAAGCATCACC
TCGCAATTGGGACAAACAAAGTGAACTGTTACTGACCACATCAAAGATCGATCCTAAGCGTGCTATTCCTCGTGA
CGAACAGGAGAAGACTTCCAAGATTTTCGTTGGTGGTGTTAGCCAGGAGGCTACCGAGCAGGACTTTAAGCAATT
CTTCATGCAGTTTGGCCGTGTTGTGGATGCCACTCTTATGATGGACAAGGACACCGGACGGCCCCGTGGATTCGG
TTTCGTCACCTTCGACGGCGATGCTGCCGTTGAGAAGGCTCTCTCCCGTCCTCTTGAGATTCTGGGCAAGCCAAT
TGAGGTCAAGAAGGCCCAGCCCCGTGGCAACCTGCGTGACAACAATGATCAACGCGGAGGCCACCGCAACGGAGG
ATACCGCGACCAAAACCAGAACGATGGAGGTCAGCAGCAAGCCCCTCAGCAGGGACAGGGTAGTTCGATGACTCC
TCAAATGATGGCCCAATACTGGCAACGCATGCAGCAGTACTTTACCATGATGCAGCATCAGATGGCCGGTCAGGG
AGGAATGCCTGGTATGAACATGGGCGCTATGAACATGAACCCCGCTATGATGGCCCAGATGCAACAAGTGCAGCA
GATGCAGATGCGTCAGCAGCAGCAACAGCAAATGGGTGCCCAGCAAGGTGCTATGAGCCCCGGCCCTCAGAGTCC
TGGCTCCCAGCAGGCTATGCCCAACATGATGAACCCGGCCATGATGCAGCCCAACCAAGCCGTTGCTGCCGGCGG
TCCTGCCAGCGATTCCGCTAGCCCTGTCCCCAATGCCGTTGCCATGGCCGCTAACTACAACAACGGAACTCCAAA
CTCAGCCAGAGGACAGACTGGACCTGGATACAACGCGACCGAGCAGATCGCCTTCGAGCAGCAGAAGTATGAACA
GCAGCAGATCAGCCGCTCGATGGATCCTCGCGGCTTCTCGCCTTACCAGCAGCAGGGTGGCCCAACCTCGTGGGA
GGGTATGTACGATGAAGTTCCTCAACCTCACGTTCCGACTGGACCAGCAGGTATGAGACGCATGGGAAGTTCGGG
TAGTGGTATGTGATTCTTACGAGTCTTTGCATATTGTGTCCCTTTCATCTCAATTCCTTTCCATTCCTACTTTAT
TTGCGCACATCAACTAACCCGTCTCTCAAACAGGAACCACTCCTCAGCCCCAGAGCACTGCTCCCGCCAATGCTC
CCACTGGACCCCGCAACGCCGGCAAGCCTGGTGCGAACTACCGTGGCGGCGGCCGAGGTGGACACCGTACCTTCC
ACCCTTACCAGCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail