Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8199.t1
Gene name
Locationscaffold_30:94128..96321
Strand+
Gene length (bp)2193
Transcript length (bp)2133
Coding sequence length (bp)2133
Protein length (aa) 711

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 2.6E-135 166 615
PF14558 TRP_N ML-like domain 5.4E-39 23 160

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 344 366 22
2 386 408 22
3 423 445 22
4 481 502 21
5 506 528 22
6 535 557 22
7 572 594 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8199.t1
MQNFIWALLGLAMVPQALASDVLSTDGFDLCMTDSAINVQKMDVTYTRSTGVVVFDLAGTNAMEQNVSATITVTA
YGSQLYSKEFDPCGDDIHVAELCPVPKGSFKATGSMDVPSAYASQIPGIAFTMPDLDGQAKLVLKSKQSQSNLAC
IQSELTNGHTTNVAAVKYVSAGIAAGALALSGVSAIGSAGTVGSPSSSPGFGDVMGWFHSMATNGMLSVAYPSVY
RSFSSNFMWSTGMIPWPGLMKSIDQFRAATGGNLTDESYEFLLNSSTTQSSSSSTNTTKRSWEYTIQFGEMVARS
VDTSTDASVSNSSSTESTSTSKITDLKQVAEELMVPSADVFMTILVIFAIVIAVVVVGILLMKVILELWALYGNF
PNKLSDFRKDYWGMMARTITNMILVLYSIWVLYCVYQLRKGDSWAAKLLAAITLSLFTALLLFFAIRIVYMARKY
KKAEGDTSRLYEDKETWKKYSLFYDNYKKDFWWIFIPVIMYALVKGCIIAGGEGHGLFQSAGQLACEVLLLGLLV
WSRPYATKASLGINIAVQVIRVLSIACVLVFVEELGMSQTTKTVTGIVLIVVQSTLTAVLAILIAVNAFISCYRE
NPHAKRRREAEKANRDIDDLTPLDARDSLLMEHPQRKQYAEMSNFNFTGPYQTYRDEPKRAGSPGNTERDRLVNN
DYGVAHARSSSPDSRHSRSSLEGRRPAAPGYGMAY*
Coding >Pro_DTO377G3_2|g8199.t1
ATGCAGAACTTCATCTGGGCTCTGCTAGGCCTGGCCATGGTGCCTCAAGCCCTGGCAAGCGACGTCCTATCTACG
GACGGATTCGACCTATGCATGACCGATTCGGCAATCAACGTCCAAAAGATGGATGTTACCTACACTCGTTCTACT
GGAGTAGTTGTCTTCGACTTGGCTGGTACCAACGCGATGGAACAGAATGTGTCGGCGACTATCACCGTCACTGCC
TATGGCAGCCAACTCTACAGTAAAGAATTTGATCCCTGCGGCGATGACATTCATGTCGCGGAACTCTGCCCCGTC
CCCAAGGGTTCTTTCAAGGCCACTGGGTCCATGGACGTCCCGTCCGCATATGCCAGTCAAATCCCTGGTATCGCA
TTCACCATGCCCGACTTGGATGGTCAGGCCAAGCTTGTCCTGAAATCCAAGCAAAGCCAGAGCAACCTGGCGTGC
ATTCAGTCGGAACTGACTAACGGCCACACCACCAACGTCGCTGCGGTCAAATACGTCTCGGCAGGCATTGCGGCA
GGCGCTCTGGCACTGAGCGGTGTCTCTGCCATCGGCTCGGCGGGAACTGTTGGATCACCGTCCTCCAGCCCTGGA
TTTGGCGATGTAATGGGCTGGTTCCATTCCATGGCCACCAACGGCATGCTTAGTGTCGCCTACCCCTCCGTCTAT
CGCAGCTTCTCCTCCAACTTCATGTGGAGTACTGGTATGATCCCTTGGCCTGGTCTGATGAAGTCCATCGACCAA
TTTCGGGCGGCCACAGGTGGTAACTTGACCGATGAAAGCTATGAGTTCTTGTTGAATTCCTCCACGACGCAAAGT
AGCTCATCCTCCACCAACACAACGAAACGGAGCTGGGAGTACACCATCCAATTCGGCGAGATGGTTGCTCGCTCG
GTTGACACTTCTACTGATGCTAGTGTTTCGAACAGCTCAAGCACTGAAAGTACATCTACCAGCAAAATCACCGAC
CTGAAGCAAGTCGCTGAAGAACTGATGGTCCCTTCTGCCGATGTTTTCATGACTATCCTCGTGATCTTCGCCATC
GTTATCGCGGTGGTTGTCGTCGGTATTCTTTTAATGAAGGTCATCCTGGAACTGTGGGCGCTGTATGGAAACTTC
CCTAACAAGCTGTCTGACTTCCGGAAGGATTATTGGGGCATGATGGCACGGACAATCACCAACATGATCCTCGTG
CTATACAGTATCTGGGTGCTATACTGTGTCTACCAACTTCGAAAGGGTGACTCGTGGGCAGCAAAGCTGCTAGCA
GCTATAACCCTCTCTCTATTCACGGCGCTTCTTCTCTTCTTTGCTATTCGCATTGTTTACATGGCTCGCAAGTAC
AAGAAGGCCGAGGGAGATACCTCCCGCCTGTACGAAGATAAAGAAACCTGGAAAAAATACAGTCTGTTCTACGAT
AACTACAAGAAGGACTTCTGGTGGATCTTCATCCCCGTCATTATGTACGCATTGGTCAAGGGCTGCATCATCGCA
GGTGGCGAGGGCCACGGTCTGTTCCAAAGCGCCGGCCAGCTTGCCTGCGAAGTCCTTCTGTTGGGACTCTTGGTG
TGGAGCCGCCCATATGCCACCAAGGCATCACTGGGCATCAACATCGCCGTTCAGGTCATCCGTGTTCTGTCCATT
GCTTGCGTTCTGGTCTTCGTTGAAGAGCTCGGCATGTCTCAAACAACAAAGACCGTCACCGGCATTGTCCTCATT
GTCGTACAGTCTACTCTCACTGCTGTCCTCGCTATCCTCATTGCAGTCAACGCCTTCATCAGCTGCTACCGTGAG
AACCCACATGCTAAGCGGAGAAGAGAAGCTGAAAAAGCAAACCGCGACATTGACGACCTCACTCCCCTAGACGCC
CGGGACTCGCTCCTCATGGAACACCCACAGCGCAAGCAATACGCCGAGATGAGCAACTTCAACTTCACCGGCCCC
TACCAGACCTACAGAGACGAGCCCAAGCGGGCCGGATCACCTGGTAACACCGAACGCGACCGCCTAGTCAATAAC
GACTACGGCGTGGCGCACGCGCGCAGCTCAAGCCCCGACAGCCGCCACTCGCGAAGCTCTCTCGAAGGCCGTCGT
CCTGCAGCCCCGGGCTACGGGATGGCATATTAA
Transcript >Pro_DTO377G3_2|g8199.t1
ATGCAGAACTTCATCTGGGCTCTGCTAGGCCTGGCCATGGTGCCTCAAGCCCTGGCAAGCGACGTCCTATCTACG
GACGGATTCGACCTATGCATGACCGATTCGGCAATCAACGTCCAAAAGATGGATGTTACCTACACTCGTTCTACT
GGAGTAGTTGTCTTCGACTTGGCTGGTACCAACGCGATGGAACAGAATGTGTCGGCGACTATCACCGTCACTGCC
TATGGCAGCCAACTCTACAGTAAAGAATTTGATCCCTGCGGCGATGACATTCATGTCGCGGAACTCTGCCCCGTC
CCCAAGGGTTCTTTCAAGGCCACTGGGTCCATGGACGTCCCGTCCGCATATGCCAGTCAAATCCCTGGTATCGCA
TTCACCATGCCCGACTTGGATGGTCAGGCCAAGCTTGTCCTGAAATCCAAGCAAAGCCAGAGCAACCTGGCGTGC
ATTCAGTCGGAACTGACTAACGGCCACACCACCAACGTCGCTGCGGTCAAATACGTCTCGGCAGGCATTGCGGCA
GGCGCTCTGGCACTGAGCGGTGTCTCTGCCATCGGCTCGGCGGGAACTGTTGGATCACCGTCCTCCAGCCCTGGA
TTTGGCGATGTAATGGGCTGGTTCCATTCCATGGCCACCAACGGCATGCTTAGTGTCGCCTACCCCTCCGTCTAT
CGCAGCTTCTCCTCCAACTTCATGTGGAGTACTGGTATGATCCCTTGGCCTGGTCTGATGAAGTCCATCGACCAA
TTTCGGGCGGCCACAGGTGGTAACTTGACCGATGAAAGCTATGAGTTCTTGTTGAATTCCTCCACGACGCAAAGT
AGCTCATCCTCCACCAACACAACGAAACGGAGCTGGGAGTACACCATCCAATTCGGCGAGATGGTTGCTCGCTCG
GTTGACACTTCTACTGATGCTAGTGTTTCGAACAGCTCAAGCACTGAAAGTACATCTACCAGCAAAATCACCGAC
CTGAAGCAAGTCGCTGAAGAACTGATGGTCCCTTCTGCCGATGTTTTCATGACTATCCTCGTGATCTTCGCCATC
GTTATCGCGGTGGTTGTCGTCGGTATTCTTTTAATGAAGGTCATCCTGGAACTGTGGGCGCTGTATGGAAACTTC
CCTAACAAGCTGTCTGACTTCCGGAAGGATTATTGGGGCATGATGGCACGGACAATCACCAACATGATCCTCGTG
CTATACAGTATCTGGGTGCTATACTGTGTCTACCAACTTCGAAAGGGTGACTCGTGGGCAGCAAAGCTGCTAGCA
GCTATAACCCTCTCTCTATTCACGGCGCTTCTTCTCTTCTTTGCTATTCGCATTGTTTACATGGCTCGCAAGTAC
AAGAAGGCCGAGGGAGATACCTCCCGCCTGTACGAAGATAAAGAAACCTGGAAAAAATACAGTCTGTTCTACGAT
AACTACAAGAAGGACTTCTGGTGGATCTTCATCCCCGTCATTATGTACGCATTGGTCAAGGGCTGCATCATCGCA
GGTGGCGAGGGCCACGGTCTGTTCCAAAGCGCCGGCCAGCTTGCCTGCGAAGTCCTTCTGTTGGGACTCTTGGTG
TGGAGCCGCCCATATGCCACCAAGGCATCACTGGGCATCAACATCGCCGTTCAGGTCATCCGTGTTCTGTCCATT
GCTTGCGTTCTGGTCTTCGTTGAAGAGCTCGGCATGTCTCAAACAACAAAGACCGTCACCGGCATTGTCCTCATT
GTCGTACAGTCTACTCTCACTGCTGTCCTCGCTATCCTCATTGCAGTCAACGCCTTCATCAGCTGCTACCGTGAG
AACCCACATGCTAAGCGGAGAAGAGAAGCTGAAAAAGCAAACCGCGACATTGACGACCTCACTCCCCTAGACGCC
CGGGACTCGCTCCTCATGGAACACCCACAGCGCAAGCAATACGCCGAGATGAGCAACTTCAACTTCACCGGCCCC
TACCAGACCTACAGAGACGAGCCCAAGCGGGCCGGATCACCTGGTAACACCGAACGCGACCGCCTAGTCAATAAC
GACTACGGCGTGGCGCACGCGCGCAGCTCAAGCCCCGACAGCCGCCACTCGCGAAGCTCTCTCGAAGGCCGTCGT
CCTGCAGCCCCGGGCTACGGGATGGCATATTAA
Gene >Pro_DTO377G3_2|g8199.t1
ATGCAGAACTTCATCTGGGCTCTGCTAGGCCTGGCCATGGTGCCTCAAGCCCTGGCAAGCGACGTCCTATCTACG
GACGGATTCGACCTATGCATGACCGATTCGGCAATCAACGTCCAAAAGATGGATGTTACCTACACTCGTTCTACT
GGAGTAGTTGTCTTCGACTTGGCTGGTACCAACGCGATGGAACAGAATGTGTCGGCGACTATCACCGTCACTGCC
TATGGCAGCCAACTCTACAGTAAAGAATTTGATCCCTGCGGCGATGACATTCATGTCGCGGAACTCTGCCCCGTC
CCCAAGGGTTCTTTCAAGGCCACTGGGTCCATGGACGTCCCGTCCGCATATGCCAGTCAAATCCCTGGTATCGCA
TTCACCATGCCCGACTTGGATGGTCAGGCCAAGCTTGTCCTGAAATCCAAGCAAAGCCAGAGCAACCTGGCGTGC
ATTCAGTCGGAACTGACTAACGGCCACACCACCAACGTCGCTGCGGTCAAATACGTCTCGGCAGGCATTGCGGCA
GGCGCTCTGGCACTGAGCGGTGTCTCTGCCATCGGCTCGGCGGGAACTGTTGGATCACCGTCCTCCAGCCCTGGA
TTTGGCGATGTAATGGGCTGGTTCCATTCCATGGCCACCAACGGCATGCTTAGTGTCGCCTACCCCTCCGTCTAT
CGCAGCTTCTCCTCCAACTTCATGTGGAGTACTGGTATGATCCCTTGGCCTGGTCTGATGAAGTCCATCGACCAA
TTTCGGGCGGCCACAGGTGGTAACTTGACCGATGAAAGCTATGAGTTCTTGTTGAATTCCTCCACGACGCAAAGT
AGCTCATCCTCCACCAACACAACGAAACGGAGCTGGGAGTACACCATCCAATTCGGCGAGATGGTTGCTCGCTCG
GTTGACACTTCTACTGATGCTAGTGTTTCGAACAGCTCAAGCACTGAAAGTACATCTACCAGCAAAATCACCGAC
CTGAAGCAAGTCGCTGAAGAACTGATGGTCCCTTCTGCCGATGTTTTCATGACTATCCTCGTGATCTTCGCCATC
GTTATCGCGGTGGTTGTCGTCGGTATTCTTTTAATGAAGGTCATCCTGGAACTGTGGGCGCTGTATGGAAACTTC
CCTAACAAGCTGTCTGACTTCCGGAAGGATTATTGGGGCATGATGGCACGGACAATCACCAACATGATCCTCGTG
CTATACAGTATCTGGGTGCTATACTGTGTCTACCAACTTCGAAAGGGTGACTCGTGGGCAGCAAAGCTGCTAGCA
GCTATAACCCTCTCTCTATTCACGGCGCTTCTTCTCTTCTTTGCTATTCGCATTGTTTACATGGCTCGCAAGTAC
AAGAAGGCCGAGGGAGATACCTCCCGCCTGTACGAAGATAAAGAAACCTGGAAAAAATACAGTCTGTTCTACGAT
AACTACAAGAAGGACTTCTGGTGGATCTTCATCCCCGTCATTATGTACGCATTGGTCAAGGGCTGCATCATCGCA
GGTGGCGAGGGCCACGGTCTGTTCCAAAGCGCCGGCCAGCTTGCCTGCGAAGTCCTTCTGTTGGGACTCTTGGTG
TGGAGCCGCCCATATGCCACCAAGGCATCACTGGGCATCAACATCGCCGTTCAGGTCATCCGTGTTCTGTCCATT
GCTTGCGTTCTGGTCTTCGTTGAAGAGCTCGGCATGTCTCAAACAACAAAGACCGTCACCGGCATTGTCCTCATT
GTCGTACAGTCTACTCTCACTGCTGTCCTCGCTATCCTCATTGCAGTCAACGCCTTCATCAGCTGCTACCGTGAG
AACCCACATGCTAAGCGGAGAAGAGAAGCTGGTAAGTCAAAGCGACGTCCCATCCCATCATGTCCATTTACTAAC
CGTCCCTTTCTTATAGAAAAAGCAAACCGCGACATTGACGACCTCACTCCCCTAGACGCCCGGGACTCGCTCCTC
ATGGAACACCCACAGCGCAAGCAATACGCCGAGATGAGCAACTTCAACTTCACCGGCCCCTACCAGACCTACAGA
GACGAGCCCAAGCGGGCCGGATCACCTGGTAACACCGAACGCGACCGCCTAGTCAATAACGACTACGGCGTGGCG
CACGCGCGCAGCTCAAGCCCCGACAGCCGCCACTCGCGAAGCTCTCTCGAAGGCCGTCGTCCTGCAGCCCCGGGC
TACGGGATGGCATATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail