Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8187.t1
Gene name
Locationscaffold_30:69137..69608
Strand-
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 16.48 4.44 28.52
5d_25C Five days - 25 degrees Celsius 26.99 8.61 45.36
7d_25C Seven days - 25 degrees Celsius 20.44 5.46 35.42
10d_25C Ten days - 25 degrees Celsius 19.33 5.37 33.30
7d_15C Seven days - 15 degrees Celsius 19.43 5.19 33.68
7d_30C Seven days - 30 degrees Celsius 26.48 8.46 44.51

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.241375 no
3d_25C 7d_25C 0.683183 no
3d_25C 7d_15C 0.769860 no
3d_25C 7d_30C 0.265482 no
3d_25C 10d_25C 0.777314 no
5d_25C 7d_25C 0.565489 no
5d_25C 7d_15C 0.484731 no
5d_25C 7d_30C 0.976410 no
5d_25C 10d_25C 0.479442 no
7d_25C 7d_15C 0.938533 no
7d_25C 7d_30C 0.599335 no
7d_25C 10d_25C 0.932718 no
7d_15C 7d_30C 0.512424 no
7d_15C 10d_25C 0.993676 no
7d_30C 10d_25C 0.504930 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8187.t1
MPSMHPLSLLTAILASALAESSSSSCWDTMHNSTLAVFSSAPIAFSLDRATALQCQAWCGQVSNCQAWVFVDQLL
QCDLHRAAPVNVLPETNGFVFGGCDPSGAVLDLPRLIYAETMVEGAASTPTTQASAISLASSSSGATPEKTHGVP
ESVCLC*
Coding >Pro_DTO377G3_2|g8187.t1
ATGCCTTCCATGCACCCCCTTTCCCTCCTCACCGCCATCTTGGCCTCGGCGCTGGCCGAGTCCTCTTCGTCCTCC
TGCTGGGACACCATGCACAACTCGACCCTCGCGGTCTTCAGCAGCGCCCCTATCGCCTTCAGTCTCGACCGTGCT
ACCGCGTTGCAGTGCCAAGCGTGGTGCGGGCAAGTCTCCAACTGCCAGGCATGGGTGTTTGTCGACCAATTGCTG
CAATGCGACCTCCACCGCGCGGCCCCGGTGAACGTTCTTCCCGAGACCAACGGATTCGTCTTCGGTGGCTGTGAC
CCTTCCGGCGCGGTCCTGGATTTGCCAAGACTAATATACGCCGAGACTATGGTCGAGGGCGCAGCCTCGACTCCC
ACTACCCAGGCTAGTGCGATTTCACTCGCCAGCAGCTCGAGTGGTGCTACCCCGGAGAAGACTCACGGGGTGCCC
GAGTCGGTATGTCTCTGTTAG
Transcript >Pro_DTO377G3_2|g8187.t1
ATGCCTTCCATGCACCCCCTTTCCCTCCTCACCGCCATCTTGGCCTCGGCGCTGGCCGAGTCCTCTTCGTCCTCC
TGCTGGGACACCATGCACAACTCGACCCTCGCGGTCTTCAGCAGCGCCCCTATCGCCTTCAGTCTCGACCGTGCT
ACCGCGTTGCAGTGCCAAGCGTGGTGCGGGCAAGTCTCCAACTGCCAGGCATGGGTGTTTGTCGACCAATTGCTG
CAATGCGACCTCCACCGCGCGGCCCCGGTGAACGTTCTTCCCGAGACCAACGGATTCGTCTTCGGTGGCTGTGAC
CCTTCCGGCGCGGTCCTGGATTTGCCAAGACTAATATACGCCGAGACTATGGTCGAGGGCGCAGCCTCGACTCCC
ACTACCCAGGCTAGTGCGATTTCACTCGCCAGCAGCTCGAGTGGTGCTACCCCGGAGAAGACTCACGGGGTGCCC
GAGTCGGTATGTCTCTGTTAG
Gene >Pro_DTO377G3_2|g8187.t1
ATGCCTTCCATGCACCCCCTTTCCCTCCTCACCGCCATCTTGGCCTCGGCGCTGGCCGAGTCCTCTTCGTCCTCC
TGCTGGGACACCATGCACAACTCGACCCTCGCGGTCTTCAGCAGCGCCCCTATCGCCTTCAGTCTCGACCGTGCT
ACCGCGTTGCAGTGCCAAGCGTGGTGCGGGCAAGTCTCCAACTGCCAGGCATGGGTGTTTGTCGACCAATTGCTG
CAATGCGACCTCCACCGCGCGGCCCCGGTGAACGTTCTTCCCGAGACCAACGGATTCGTCTTCGGTGGCTGTGAC
CCTTCCGGCGCGGTCCTGGATTTGCCAAGACTAATATACGCCGAGACTATGGTCGAGGGCGCAGCCTCGACTCCC
ACTACCCAGGCTAGTGCGATTTCACTCGCCAGCAGCTCGAGTGGTGCTACCCCGGAGAAGACTCACGGGGTGCCC
GAGTCGGTATGTCTCTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail