Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8172.t1
Gene name
Locationscaffold_30:23780..25701
Strand-
Gene length (bp)1921
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 9.1E-31 92 399

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 284.65 160.44 408.86
5d_25C Five days - 25 degrees Celsius 170.68 96.87 244.49
7d_25C Seven days - 25 degrees Celsius 154.33 84.16 224.49
10d_25C Ten days - 25 degrees Celsius 95.48 51.59 139.36
7d_15C Seven days - 15 degrees Celsius 136.24 62.09 210.40
7d_30C Seven days - 30 degrees Celsius 201.64 100.12 303.15

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.021163 yes
3d_25C 7d_25C 0.007779 yes
3d_25C 7d_15C 0.008133 yes
3d_25C 7d_30C 0.207071 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.757578 no
5d_25C 7d_15C 0.460769 no
5d_25C 7d_30C 0.604237 no
5d_25C 10d_25C 0.014377 yes
7d_25C 7d_15C 0.732122 no
7d_25C 7d_30C 0.375411 no
7d_25C 10d_25C 0.056706 no
7d_15C 7d_30C 0.201629 no
7d_15C 10d_25C 0.235181 no
7d_30C 10d_25C 0.002761 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8172.t1
MRSLWALSALAFSVKAIQTTGCPILGPAFPAPTALSEDPTFLSKAEELTSKLNDAIKNGSLPAISFAVQVFSSEE
DDAPFDFYHTDDPVKVGSVGVQEVDEDTMFRIGSISKLWTMFLFMTLEGTQYFHEPVSKYVPELRTNYSAAQAKD
TINYLQWSDVTIGELASHQAGLARDYAFGDLEFESELLQGMGFPALLKNDQLTCGSTSTCDRKEFFRGILQTHPL
TATSQTPIYSNAGYQILGYVLESIAKADFEDILLDRLIKPLNLTRSCLQIPDPSLAVIPYNETFSWFGYQIGEEA
PAGGMFSSAKDMATFGRAILSNTLVDPAVTRRWLRPMAHTSSLQLSVGAPWEIYTFLTPRRVDLYTKAGDIGLYS
SSIGLSPDHNAGFTVLVAGANSHAMTAQIGEMVADIMLPALDEVARNQAFERFGGTYALTSDSFNSSITVMADDG
PGLVVSAWISNSVDMIESLMTLQGVADRSAIGIRLQPSGLETPGRISFLAVIYALPISEDAGPFIGSCFSWILLE
SMVYGNVGLPEFEFTLDHDGDATSLSPRALRVTLPRV*
Coding >Pro_DTO377G3_2|g8172.t1
ATGCGCTCGCTGTGGGCATTATCGGCACTGGCTTTCTCAGTTAAAGCCATACAAACAACAGGATGTCCTATTTTG
GGACCGGCATTCCCTGCCCCTACCGCTCTTTCAGAGGATCCTACTTTCCTTAGCAAAGCTGAGGAATTGACCTCA
AAGCTCAATGATGCCATTAAAAATGGAAGTCTGCCCGCCATATCCTTCGCAGTGCAGGTCTTTAGCAGCGAAGAG
GACGACGCACCATTCGATTTCTACCACACAGATGATCCAGTTAAAGTTGGATCTGTGGGCGTTCAAGAGGTCGAC
GAGGATACCATGTTCCGCATTGGCAGCATATCAAAGCTGTGGACTATGTTTCTCTTCATGACCCTGGAAGGAACA
CAGTACTTCCACGAGCCCGTTTCGAAATACGTTCCTGAGCTGCGAACAAACTACAGTGCAGCACAGGCCAAAGAT
ACAATTAATTATTTGCAATGGAGCGATGTGACGATCGGCGAGCTGGCTAGTCACCAAGCGGGCCTTGCAAGAGAC
TATGCATTTGGAGACCTCGAATTTGAGTCAGAGCTTCTGCAGGGCATGGGGTTCCCTGCGCTCCTAAAAAATGAT
CAACTGACTTGTGGGAGCACGTCTACGTGTGATAGGAAGGAATTCTTCCGTGGCATTCTACAAACGCATCCCTTG
ACTGCAACATCACAGACCCCGATATACTCAAACGCAGGATATCAAATTCTAGGCTACGTGTTGGAGTCAATCGCA
AAAGCCGACTTTGAAGATATATTACTGGACCGTCTTATCAAGCCACTCAACTTGACTCGGTCTTGTCTTCAAATC
CCAGACCCCAGCTTGGCAGTGATTCCCTACAATGAGACTTTCAGTTGGTTTGGGTATCAGATTGGTGAAGAAGCT
CCTGCCGGAGGCATGTTCTCTTCTGCAAAGGATATGGCTACATTTGGCCGTGCCATTCTTTCCAACACCCTTGTT
GACCCTGCCGTGACAAGAAGGTGGCTGAGGCCGATGGCTCACACATCATCCCTGCAACTGTCCGTGGGCGCCCCC
TGGGAAATCTATACATTTTTGACACCTCGTCGGGTCGACCTGTATACCAAGGCTGGGGACATCGGACTGTACTCC
AGTTCGATCGGTCTTTCACCGGATCACAATGCCGGTTTCACGGTTCTAGTAGCCGGAGCTAACTCTCACGCGATG
ACAGCACAAATCGGAGAAATGGTTGCCGATATTATGCTTCCCGCGCTTGATGAAGTCGCTAGAAACCAAGCCTTT
GAACGCTTTGGCGGTACATATGCCTTGACGAGCGACTCCTTCAATTCCTCAATCACCGTCATGGCTGATGACGGG
CCGGGTCTGGTGGTCTCAGCATGGATTAGCAACTCGGTGGACATGATCGAATCTTTGATGACTTTGCAAGGGGTA
GCTGATCGCTCTGCGATAGGCATTCGTCTACAGCCTAGTGGTCTTGAGACCCCAGGGCGGATCTCCTTCCTGGCT
GTCATTTATGCACTTCCTATCTCGGAAGATGCTGGGCCTTTTATTGGCTCCTGCTTTTCGTGGATTTTGCTTGAG
TCAATGGTGTATGGCAACGTGGGCCTTCCAGAGTTTGAATTCACTCTGGATCATGATGGAGATGCGACGAGCTTA
TCCCCCCGGGCGTTGCGCGTTACTCTCCCTAGAGTTTAA
Transcript >Pro_DTO377G3_2|g8172.t1
ATGCGCTCGCTGTGGGCATTATCGGCACTGGCTTTCTCAGTTAAAGCCATACAAACAACAGGATGTCCTATTTTG
GGACCGGCATTCCCTGCCCCTACCGCTCTTTCAGAGGATCCTACTTTCCTTAGCAAAGCTGAGGAATTGACCTCA
AAGCTCAATGATGCCATTAAAAATGGAAGTCTGCCCGCCATATCCTTCGCAGTGCAGGTCTTTAGCAGCGAAGAG
GACGACGCACCATTCGATTTCTACCACACAGATGATCCAGTTAAAGTTGGATCTGTGGGCGTTCAAGAGGTCGAC
GAGGATACCATGTTCCGCATTGGCAGCATATCAAAGCTGTGGACTATGTTTCTCTTCATGACCCTGGAAGGAACA
CAGTACTTCCACGAGCCCGTTTCGAAATACGTTCCTGAGCTGCGAACAAACTACAGTGCAGCACAGGCCAAAGAT
ACAATTAATTATTTGCAATGGAGCGATGTGACGATCGGCGAGCTGGCTAGTCACCAAGCGGGCCTTGCAAGAGAC
TATGCATTTGGAGACCTCGAATTTGAGTCAGAGCTTCTGCAGGGCATGGGGTTCCCTGCGCTCCTAAAAAATGAT
CAACTGACTTGTGGGAGCACGTCTACGTGTGATAGGAAGGAATTCTTCCGTGGCATTCTACAAACGCATCCCTTG
ACTGCAACATCACAGACCCCGATATACTCAAACGCAGGATATCAAATTCTAGGCTACGTGTTGGAGTCAATCGCA
AAAGCCGACTTTGAAGATATATTACTGGACCGTCTTATCAAGCCACTCAACTTGACTCGGTCTTGTCTTCAAATC
CCAGACCCCAGCTTGGCAGTGATTCCCTACAATGAGACTTTCAGTTGGTTTGGGTATCAGATTGGTGAAGAAGCT
CCTGCCGGAGGCATGTTCTCTTCTGCAAAGGATATGGCTACATTTGGCCGTGCCATTCTTTCCAACACCCTTGTT
GACCCTGCCGTGACAAGAAGGTGGCTGAGGCCGATGGCTCACACATCATCCCTGCAACTGTCCGTGGGCGCCCCC
TGGGAAATCTATACATTTTTGACACCTCGTCGGGTCGACCTGTATACCAAGGCTGGGGACATCGGACTGTACTCC
AGTTCGATCGGTCTTTCACCGGATCACAATGCCGGTTTCACGGTTCTAGTAGCCGGAGCTAACTCTCACGCGATG
ACAGCACAAATCGGAGAAATGGTTGCCGATATTATGCTTCCCGCGCTTGATGAAGTCGCTAGAAACCAAGCCTTT
GAACGCTTTGGCGGTACATATGCCTTGACGAGCGACTCCTTCAATTCCTCAATCACCGTCATGGCTGATGACGGG
CCGGGTCTGGTGGTCTCAGCATGGATTAGCAACTCGGTGGACATGATCGAATCTTTGATGACTTTGCAAGGGGTA
GCTGATCGCTCTGCGATAGGCATTCGTCTACAGCCTAGTGGTCTTGAGACCCCAGGGCGGATCTCCTTCCTGGCT
GTCATTTATGCACTTCCTATCTCGGAAGATGCTGGGCCTTTTATTGGCTCCTGCTTTTCGTGGATTTTGCTTGAG
TCAATGGTGTATGGCAACGTGGGCCTTCCAGAGTTTGAATTCACTCTGGATCATGATGGAGATGCGACGAGCTTA
TCCCCCCGGGCGTTGCGCGTTACTCTCCCTAGAGTTTAA
Gene >Pro_DTO377G3_2|g8172.t1
ATGCGCTCGCTGTGGGCATTATCGGCACTGGCTTTCTCAGTTAAAGCCATACAAACAACAGGATGTCCTATTTTG
GGACCGGCATTCCCTGCCCCTACCGCTCTTTCAGAGGATCCTACTTTCCTTAGCAAAGCTGAGGAATTGACCTCA
AAGCTCAATGATGCCATTAAAAATGGAAGTCTGCCCGCCATATCCTTCGCAGTGCAGGTCTTTAGCAGCGAAGAG
GACGACGCACCATTCGATTTCTACCACACAGATGATCCAGTTAAAGTTGGATCTGTGGGCGTTCAAGAGGTCGAC
GAGGATACCATGTTCCGCATTGGCAGCATATCAAAGCTGTGGACTATGTTTCTCTTCATGACCCTGGAAGGAACA
CAGTACTTCCACGAGCCCGTTTCGAAATACGTTCCTGAGCTGCGAACAAACTACAGTGCAGCACAGGCCAAAGAT
ACAATTAATTATTTGCAATGGAGCGATGTGACGATCGGCGAGCTGGCTAGTCACCAAGCGGGCCTTGCAAGAGAC
TGTATGATCATAACCTGGCGACGCGAGTGTGCACCGTGAAAAAGAAATTGACCTTTGATTTCAGATGCATTTGGA
GACCTCGAATTTGAGTCAGAGCTTCTGCAGGGCATGGGGTTCCCTGCGCTCCTAAAAAATGATCAACTGACTTGT
GGGAGCACGTCTACGTGTGATAGGAAGGGTAAGTCAATTGTGTGCGCTCATAATATGGTCGAATTGTTTGGCTGA
CAGCGGGAATGTTTTCAAGAATTCTTCCGTGGCATTCTACAAACGCGTGAGTAGACATGATACCGCTGAACTTAG
ACATACCCCTAACATGGCCTATTAGATCCCTTGACTGCAACATCACAGACCCCGATATACTCAAACGCAGGATAT
CAAATTCTAGGCTACGTGTTGGAGTCAATCGCAAAAGCCGACTTTGAAGATATATTACTGGACCGTCTTATCAAG
CCACTCAACTTGACTCGGTCTTGTCTTCAAATCCCAGACCCCAGCTTGGCAGTGATTCCCTACAATGAGACTTTC
AGTTGGTTTGGGTATCAGATTGGTGAAGAAGCTCCGTGAGTGCTAATGAGCCATTTGAAGTATACATAGCTTACA
TATTACTAGTGCCGGAGGCATGTTCTCTTCTGCAAAGGATATGGCTACATTTGGCCGTGCCATTCTTTCCAACAC
CCTTGTTGACCCTGCCGTGACAAGAAGGTGGCTGAGGCCGATGGCTCACACATCATCCCTGCAACTGTCCGTGGG
CGCCCCCTGGGAAATCTATACATTTTTGACACCTCGTCGGGTCGACCTGTATACCAAGGCTGGGGACATCGGACT
GTACTCCAGTTCGATCGGTCTTTCACCGGATCACAATGCCGGTTTCACGGTTCTAGTAGCCGGAGCTAACTCTCA
CGCGATGACAGCACAAATCGGAGAAATGGTTGCCGATATTATGCTTCCCGCGCTTGATGAAGTCGCTAGAAACCA
AGCCTTTGAACGCTTTGGCGGTACATATGCCTTGACGAGCGACTCCTTCAATTCCTCAATCACCGTCATGGCTGA
TGACGGGCCGGGTCTGGTGGTCTCAGCATGGATTAGCAACTCGGTGGACATGATCGAATCTTTGATGACTTTGCA
AGGGGTAGCTGATCGCTCTGCGATAGGCATTCGTCTACAGCCTAGTGGTCTTGAGACCCCAGGGCGGATCTCCTT
CCTGGCTGTCATTTATGCACTTCCTATCTCGGAAGATGCTGGGCCTTTTATTGGCTCCTGCTTTTCGTGGATTTT
GCTTGAGTCAATGGTGTATGGCAACGTGGGCCTTCCAGAGTTTGAATTCACTCTGGATCATGATGGAGATGCGAC
GAGCTTATCCCCCCGGGCGTTGCGCGTTACTCTCCCTAGAGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail