Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8155.t1
Gene name
Locationscaffold_29:250333..253899
Strand-
Gene length (bp)3566
Transcript length (bp)2076
Coding sequence length (bp)2076
Protein length (aa) 692

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.8E-45 37 418
PF00106 adh_short short chain dehydrogenase 1.5E-07 477 587

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 13.26 6.72 19.80
5d_25C Five days - 25 degrees Celsius 15.73 8.32 23.14
7d_25C Seven days - 25 degrees Celsius 14.04 7.18 20.90
10d_25C Ten days - 25 degrees Celsius 13.72 7.00 20.44
7d_15C Seven days - 15 degrees Celsius 21.74 11.97 31.51
7d_30C Seven days - 30 degrees Celsius 13.59 6.83 20.36

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.609958 no
3d_25C 7d_25C 0.887343 no
3d_25C 7d_15C 0.047513 yes
3d_25C 7d_30C 0.952506 no
3d_25C 10d_25C 0.935722 no
5d_25C 7d_25C 0.752440 no
5d_25C 7d_15C 0.232457 no
5d_25C 7d_30C 0.669276 no
5d_25C 10d_25C 0.690337 no
7d_25C 7d_15C 0.090497 no
7d_25C 7d_30C 0.936813 no
7d_25C 10d_25C 0.957304 no
7d_15C 7d_30C 0.062295 no
7d_15C 10d_25C 0.064965 no
7d_30C 10d_25C 0.984712 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8155.t1
MESKHTPVPNGMTSFWRTEPHFLDSHRSTESLPRECDIVVVGAGYAGASVVHHILDQLSPGSTPPSIVILEARQA
CSGATGRNGGHMKPDVYNGIASLAVDHGVEAAAEVAAFEAKHVSFLKEFVEREKIDCEYTVTKAIDVQLSRSYSA
TLKKAYDGLIEKGCEATTKAKYIPRNEAEKFSGVKGAQGCFTYDAGHIWPYKFVLHLLEKAIAEGVNLQTHTPVS
GIIKSTPSTSSHPWTVNTARGSVAAKTVVLATNAYTSSLAPQYKEKIIPVRGTCSRIVVPRGSTAPPLTNTYTLR
WNNWNYDYLIPRADGSIVVGGARPAFIDDLDSWYNVSDDSLVLEPAVRYWDNYMQRNFVGWENSHAYTDRVWTGI
MGYSSDGLPHIGLVPGQKDQYIIAGFTGHGMPQIFLAAEGLAKMVLNDIDFAKTGLPRLFESTQSRLDSRQNKIF
DSTPGAGKPQARLFKYQLPVEEAFRSQLRLADILYCVAGGNYNQNGFFVDLTAKDLENCMRNNHLSAAYAVKTMM
DIWLDEDTSEVEPTRQRHREIIFINSCAAFLGLPGSVTYTTAKTAVMRALADNLRIEVLHHNCTYSKYSIHIAFP
GDFISPGFIKEQQTKVPLNKKIQGLEQPMAQLLHKFPTSDKVHCPSPKRGWGVFDALMSPLMGWIVLPYLRWKWE
GLTKKDGEELQKSRVK*
Coding >Pro_DTO377G3_2|g8155.t1
ATGGAATCGAAGCATACCCCAGTCCCAAATGGGATGACGTCATTCTGGCGGACAGAGCCTCACTTTCTGGACAGC
CATCGATCAACCGAATCTCTCCCTCGGGAGTGTGATATCGTCGTTGTAGGAGCTGGATATGCAGGAGCATCTGTT
GTGCACCATATTCTCGACCAACTTAGCCCCGGGTCGACGCCGCCTTCGATTGTGATTCTGGAGGCTCGACAGGCT
TGTTCCGGTGCCACTGGTCGAAATGGAGGACACATGAAGCCGGATGTTTATAATGGTATCGCTAGCTTGGCCGTT
GATCATGGTGTCGAGGCTGCTGCTGAGGTTGCCGCTTTCGAGGCTAAGCATGTCTCGTTTCTCAAGGAGTTCGTC
GAAAGAGAAAAGATAGACTGTGAATACACCGTCACAAAGGCTATCGATGTTCAGTTGTCTCGGAGCTATAGCGCA
ACACTCAAGAAGGCATACGATGGATTGATCGAGAAGGGGTGTGAAGCGACCACGAAGGCAAAATATATCCCCAGA
AACGAGGCCGAGAAGTTCTCTGGAGTCAAAGGGGCACAAGGTTGTTTCACATATGACGCCGGTCACATTTGGCCA
TACAAATTCGTGCTGCACCTTCTGGAAAAAGCAATTGCGGAAGGTGTAAATTTACAGACGCACACACCTGTATCT
GGAATTATAAAGTCTACTCCCTCAACATCCAGCCATCCTTGGACAGTGAATACTGCCCGAGGTTCTGTTGCCGCC
AAGACAGTGGTTCTAGCAACGAATGCCTATACTTCGTCTCTAGCCCCGCAATATAAGGAGAAGATTATCCCTGTC
CGAGGAACATGCAGCCGAATTGTCGTGCCTCGAGGTTCTACCGCTCCTCCTCTGACGAATACTTACACCCTGCGC
TGGAACAATTGGAATTACGACTACCTCATCCCACGCGCCGATGGGAGTATAGTCGTTGGCGGTGCTCGCCCGGCT
TTCATCGATGATCTAGACAGCTGGTACAATGTCAGTGATGACAGCCTGGTTCTTGAGCCTGCTGTCCGATACTGG
GATAATTATATGCAGCGGAACTTTGTCGGTTGGGAAAATAGCCACGCTTACACGGACAGGGTCTGGACAGGAATC
ATGGGCTATTCGTCGGATGGATTACCGCATATTGGCCTTGTCCCAGGACAGAAGGATCAGTACATTATCGCTGGG
TTCACGGGACATGGAATGCCTCAAATTTTCCTGGCGGCCGAGGGCTTGGCAAAAATGGTACTCAATGATATCGAT
TTTGCAAAGACTGGACTCCCGCGGCTATTTGAGTCTACTCAGTCCCGGCTTGATAGTCGCCAGAACAAGATATTC
GATAGCACCCCCGGGGCTGGGAAACCCCAAGCAAGACTGTTTAAATACCAGCTACCTGTTGAAGAAGCATTCAGA
TCGCAGCTTCGGCTCGCAGATATCTTATACTGTGTCGCTGGTGGCAACTATAACCAGAACGGCTTCTTCGTTGAC
CTCACAGCAAAAGACCTTGAGAACTGCATGCGAAATAACCACCTCTCCGCTGCATATGCTGTAAAGACTATGATG
GACATATGGCTTGACGAGGATACCTCAGAAGTCGAGCCGACCCGTCAGCGACACCGAGAGATCATCTTCATCAAC
AGCTGTGCGGCATTCCTAGGTCTTCCTGGCTCAGTTACATACACCACTGCGAAGACCGCAGTGATGCGTGCCCTT
GCCGATAACCTCCGTATAGAAGTCCTCCATCACAACTGCACGTACTCAAAATACTCGATCCATATCGCCTTCCCG
GGTGATTTCATATCCCCGGGCTTCATAAAGGAGCAGCAGACAAAAGTTCCCCTCAACAAGAAGATCCAAGGGTTG
GAGCAACCCATGGCACAGCTTTTGCACAAGTTCCCGACGTCGGACAAGGTTCATTGCCCGTCACCCAAGCGGGGA
TGGGGTGTGTTTGATGCGCTGATGTCGCCATTAATGGGTTGGATTGTGCTGCCCTATTTGCGATGGAAATGGGAG
GGCTTGACCAAGAAGGACGGTGAGGAGCTGCAGAAGTCTAGGGTGAAGTAA
Transcript >Pro_DTO377G3_2|g8155.t1
ATGGAATCGAAGCATACCCCAGTCCCAAATGGGATGACGTCATTCTGGCGGACAGAGCCTCACTTTCTGGACAGC
CATCGATCAACCGAATCTCTCCCTCGGGAGTGTGATATCGTCGTTGTAGGAGCTGGATATGCAGGAGCATCTGTT
GTGCACCATATTCTCGACCAACTTAGCCCCGGGTCGACGCCGCCTTCGATTGTGATTCTGGAGGCTCGACAGGCT
TGTTCCGGTGCCACTGGTCGAAATGGAGGACACATGAAGCCGGATGTTTATAATGGTATCGCTAGCTTGGCCGTT
GATCATGGTGTCGAGGCTGCTGCTGAGGTTGCCGCTTTCGAGGCTAAGCATGTCTCGTTTCTCAAGGAGTTCGTC
GAAAGAGAAAAGATAGACTGTGAATACACCGTCACAAAGGCTATCGATGTTCAGTTGTCTCGGAGCTATAGCGCA
ACACTCAAGAAGGCATACGATGGATTGATCGAGAAGGGGTGTGAAGCGACCACGAAGGCAAAATATATCCCCAGA
AACGAGGCCGAGAAGTTCTCTGGAGTCAAAGGGGCACAAGGTTGTTTCACATATGACGCCGGTCACATTTGGCCA
TACAAATTCGTGCTGCACCTTCTGGAAAAAGCAATTGCGGAAGGTGTAAATTTACAGACGCACACACCTGTATCT
GGAATTATAAAGTCTACTCCCTCAACATCCAGCCATCCTTGGACAGTGAATACTGCCCGAGGTTCTGTTGCCGCC
AAGACAGTGGTTCTAGCAACGAATGCCTATACTTCGTCTCTAGCCCCGCAATATAAGGAGAAGATTATCCCTGTC
CGAGGAACATGCAGCCGAATTGTCGTGCCTCGAGGTTCTACCGCTCCTCCTCTGACGAATACTTACACCCTGCGC
TGGAACAATTGGAATTACGACTACCTCATCCCACGCGCCGATGGGAGTATAGTCGTTGGCGGTGCTCGCCCGGCT
TTCATCGATGATCTAGACAGCTGGTACAATGTCAGTGATGACAGCCTGGTTCTTGAGCCTGCTGTCCGATACTGG
GATAATTATATGCAGCGGAACTTTGTCGGTTGGGAAAATAGCCACGCTTACACGGACAGGGTCTGGACAGGAATC
ATGGGCTATTCGTCGGATGGATTACCGCATATTGGCCTTGTCCCAGGACAGAAGGATCAGTACATTATCGCTGGG
TTCACGGGACATGGAATGCCTCAAATTTTCCTGGCGGCCGAGGGCTTGGCAAAAATGGTACTCAATGATATCGAT
TTTGCAAAGACTGGACTCCCGCGGCTATTTGAGTCTACTCAGTCCCGGCTTGATAGTCGCCAGAACAAGATATTC
GATAGCACCCCCGGGGCTGGGAAACCCCAAGCAAGACTGTTTAAATACCAGCTACCTGTTGAAGAAGCATTCAGA
TCGCAGCTTCGGCTCGCAGATATCTTATACTGTGTCGCTGGTGGCAACTATAACCAGAACGGCTTCTTCGTTGAC
CTCACAGCAAAAGACCTTGAGAACTGCATGCGAAATAACCACCTCTCCGCTGCATATGCTGTAAAGACTATGATG
GACATATGGCTTGACGAGGATACCTCAGAAGTCGAGCCGACCCGTCAGCGACACCGAGAGATCATCTTCATCAAC
AGCTGTGCGGCATTCCTAGGTCTTCCTGGCTCAGTTACATACACCACTGCGAAGACCGCAGTGATGCGTGCCCTT
GCCGATAACCTCCGTATAGAAGTCCTCCATCACAACTGCACGTACTCAAAATACTCGATCCATATCGCCTTCCCG
GGTGATTTCATATCCCCGGGCTTCATAAAGGAGCAGCAGACAAAAGTTCCCCTCAACAAGAAGATCCAAGGGTTG
GAGCAACCCATGGCACAGCTTTTGCACAAGTTCCCGACGTCGGACAAGGTTCATTGCCCGTCACCCAAGCGGGGA
TGGGGTGTGTTTGATGCGCTGATGTCGCCATTAATGGGTTGGATTGTGCTGCCCTATTTGCGATGGAAATGGGAG
GGCTTGACCAAGAAGGACGGTGAGGAGCTGCAGAAGTCTAGGGTGAAGTAA
Gene >Pro_DTO377G3_2|g8155.t1
ATGGAATCGAAGCATACCCCAGTCCCAAATGGGATGACGTCATTCTGGCGGACAGAGCCTCACTTTCTGGACAGC
CATCGATCAACCGAATCTCTCCCTCGGGAGTGTGATATCGTCGTTGTAGGAGCTGGATATGCAGGAGCATCTGTT
GTGCACCATATTCTCGACCAACTTAGCCCCGGGTCGACGCCGCCTTCGATTGTGATTCTGGAGGCTCGACAGGCT
TGTTCCGGTGCCACTGGTCGAAATGGTAAGATTGGATAGTTAAAAGTGATAAACTTTGCTAAAATATTTATGTTC
TGCTTATTGTAGGAGGACACATGAAGCCGGATGTTTATAATGGTATCGCTAGCTTGGCCGTTGATCATGGTGTCG
AGGCTGCTGCTGAGGTTGCCGCTTTCGAGGCTAAGCATGTCTCGTTTCTCAAGGAGTTCGTCGAAAGAGAAAAGA
TAGACTGTGAATACACCGTCACAAAGGCTATCGATGTTCAGTTGTCTCGGAGCTATAGCGCAACACTCAAGAAGG
CATACGATGGATTGATCGAGAAGGGGTGTGAAGCGACCACGAAGGCAAAATATATCCCCAGAAACGAGGCCGAGA
AGGTGAGCACATGTTCGAAATGTCGTATTTCGATATACTGACCAGCTGTACATCAGTTCTCTGGAGTCAAAGGGG
CACAAGGTTGTTTCACATATGACGCCGGTCACATTTGGCCATACAAATTCGTGCTGCACCTTCTGGAAAAAGCAA
TTGCGGAAGGTGTAAATTTACAGACGCACACACCTGTATCTGGAATTATAAAGTCTACTCCCTCAACATCCAGCC
ATCCTTGGACAGTGAATACTGCCCGAGGTTCTGTTGCCGCCAAGACAGTGGTTCTAGCAACGAATGCCTATACTT
CGTCTCTAGCCCCGCAATATAAGGAGAAGATTATCCCTGTCCGAGGAACATGCAGCCGAATTGTCGTGCCTCGAG
GTTCTACCGCTCCTCCTCTGACGAATACTTACACCCTGCGCTGGAACAATTGGAATTACGACTACCTCATCCCAC
GCGCCGATGGGAGTATAGTCGTTGGCGGTGCTCGCCCGGCTTTCATCGATGATCTAGACAGCTGGTACAATGTCA
GTGATGACAGCCTGGTTCTTGAGCCTGCTGTCCGATACTGGGATAATTATATGCAGCGGAACTTTGTCGGTTGGG
AAAATAGCCACGCTTACACGGACAGGGTCTGGACAGGAAGTACGTTGCTCAATCTATGATTTCCCTGCGTGTACC
ACTGAACTGACTCAACTTCTCTATAGTCATGGGCTATTCGTCGGATGGATTACCGCATATTGGCCTTGTCCCAGG
ACAGAAGGATCAGTACATTATCGCTGGGTTCACGGGACATGGAATGCCTCAAATTTTCCTGGCGGCCGAGGGCTT
GGCAAAAATGGTACTCAATGATATCGATTTTGCAAAGACTGGACTCCCGCGGCTATTTGAGTCTACTCAGTCCCG
GCTTGATAGTCGCCAGAACAAGATATTCGATAGCACCCCCGGGGCTGGGAAACCCCAAGCAAGACTGTGAGCAGG
ATTCAAATTTTAGATGCACCACTACTAGCGATTTAATGAGGTACATATACACATGTCTTTGTATTGCATGTTAGC
ATAATAAATAGTGGTGGATTTTTGTTGTTTATTCCGTATAGAACCTTCCAGGTTTAAATACCAGCTACCTGTAAG
CGACCACTCGGGGTGGTGACGCATACGGGTTATAGTTTGCTGAGCGTAGACGAATCAAAGTCTAGGTTATATACT
CTATATGAGCCTTTAGGCATTCGAACCTACCCCCACCCCTACCCCTGGGGGGGTAGGCGGTAGGGGTAGACTTAT
CTGCTTATTTACTTACTTACTTGCTTAAATGACCTACAGCCGGCTTAGTGGCTACGCTGTGACTTACTTACTTAC
TTGCTTACTTGCTTACTTGCTTTCTTAAATGGCCTGCAGCCGGCTTAGTAGCTACGCCGTGGTTTACTTATTTAC
TTACTTACTTACTTGCTTTCTTAAATGGTCTATAGCCGGCTTAGCGGCTACGCCGCGGTTTAATTATTTAATTAT
TTAATTGGTTGATTGTTTGCTTGGTTAAAGGCCGCCTAATTTGGGGTAGTTAACCTAACTAACTTGTCAGAATCT
AGGATGAATACTGTCATTTTTCATCCCTGATACAGTTGGGTCACGTGACTGACCAGGCTGGTTTTCTGCAGAAAA
ACCAACTCAGTGGTTTTTCGCCCGAAAAACCCCGAAAAACCAGTCCCGCAGTTTTTCGCCCGAAAAACATCCTTC
CATTTTGTTTTGTTTGTTTTGATTACTAAGTTGTCCACAAGATTGTCATGTTTTAGGACTATTGTCATTTTTAGA
GAGTTAGAGAATTTATTGAGATTTTTCTGCCACATATACACTCGCCTTACCACCGTTTTTCCGTCATAACTAACT
AGTTAACTAACTAACTAGGCCTAGTATTCCCTTGCCTAAACGACTCTATTATTTTGCTGAGCGAAGCGAGGCAAA
ATAAGCAAACACGCTCATTCTTCGTCAAAGTGGTGGCTATAAGATTTCACGAAGCTACTACAATTTGTATATAAG
CCACTAACAAAATCAAGTCACTTTATCATATCACATCATCTACTTCATCGTCAACAACTACTTCAAATTTTCTTG
ATTCAAGGTTTGAATTGACCCAAAGCGCAGTTGACTGATATTCTTCTGCTTCTCTAGGTTGAAGAAGCATTCAGA
TCGCAGCTTCGGCTCGCAGATATCTTATACTGTGTCGCTGGTGGCAACTATAACCAGAACGGCTTCTTCGTTGAC
CTCACAGCAAAAGACCTTGAGAACTGCATGCGAAATAACCACCTCTCCGCTGCATATGCTGTAAAGACTATGATG
GACATATGGCTTGACGAGGATACCTCAGAAGTCGAGCCGACCCGTCAGCGACACCGAGAGATCATCTTCATCAAC
AGCTGTGCGGCATTCCTAGGTCTTCCTGGCTCAGTTACATACACCAGTAAGTCGCGGCCTTGTACCACACTAGCT
GGTAATAACTGATAAATATTGCTTCCTTATAGCTGCGAAGACCGCAGTGATGCGTGCCCTTGCCGATAACCTCCG
TATAGAAGTCCTCCATCACAACTGCACGTACTCAAAATACTCGATCCATATCGCCTTCCCGGGTGATTTCATATC
CCCGGGCTTCATAAAGGAGCAGCAGACAAAAGTTCCCCTCAACAAGAAGATCCAAGGGTTGGAGCAACCCATGGC
ACAGCTTTTGCACAAGTTCCCGACGTCGGACAAGGTTCATTGTATGTGCTACTGATAGGGGCGATTTCATCATCT
GTGAGGACTCCTTTGCTGCAAATGCCTTGTTTTCGAATATGCTAGGCCCGTCACCCAAGCGGGGATGGGGTGTGT
TTGATGCGCTGATGTCGCCATTAATGGGTTGGATTGTGCTGCCCTATTTGCGATGGAAATGGGAGGGCTTGACCA
AGAAGGACGGTGAGGAGCTGCAGAAGTCTAGGGTGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail