Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8150.t1
Gene name
Locationscaffold_29:230881..232737
Strand-
Gene length (bp)1856
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00230 MIP Major intrinsic protein 1.4E-39 326 560

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015267 channel activity Yes
GO:0008150 biological_process No
GO:0022803 passive transmembrane transporter activity No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 374 396 22
2 408 430 22
3 457 479 22
4 492 514 22
5 542 564 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8150.t1
MSGGRPRARSDALPQSPNRNRAASDADYTSPRRTTSPRRTTSPRRTSAEDGGVPRRFNSNTSTTQSNGSALPSLI
PRTTLAQRTQGKFTLAGPDGTPQLRLAQEPFVQPGYADLNPSYEQASNARPVWSLAKPLPRVVRPSMVPTKDELL
QNMANAQRPTENSDRLGLDVDPNDVEQGRIDKTSDPRKMAAQVKDARLQRENTFMSKILSGDGGSSMRQTSRMSR
SSSIPGRRTSTWDMPPPDQQLPTVEEGDHPAEDEHEQEERPMSADEQFQNNQDMGARLDELLSLPEMEKGNYPED
LHPLVQELVEDEVHNNHTTWSVVRTHHREALAEGLGVFVSLTMGFAIDVSVTVAGQGNPNTTAWAWGFATMIGIY
ISGGVSGAHLNPVVTMVLWFFRGFPARKMPEYLAAQFIAAFCAGLVAYGIYYESIQNYLLTNADTGIINSFVTNP
RESWVSHTTAFFTEFVGTSFLIVTILALGDDQNAPPGAGMNSLIVGLVITSLLMCFAYQTGAAFNPSRDFGPRLA
LLAFGYPNSMFTDPYWFYGPWVGCVGGGFFGAFLYDFFIFTGGESPVNYPLERTQRALTKSAMRWRRRLRLKPKQ
*
Coding >Pro_DTO377G3_2|g8150.t1
ATGAGTGGGGGTCGTCCGAGGGCGAGATCCGATGCTCTGCCACAGTCACCGAACCGCAACCGAGCCGCCAGCGAT
GCAGATTATACCTCACCTAGGAGAACTACCTCACCCAGGAGAACTACCTCACCTCGGAGAACTTCCGCTGAGGAT
GGCGGCGTTCCTCGGCGATTCAACTCGAATACCTCGACGACACAAAGTAATGGTAGTGCACTACCCAGTTTGATC
CCGCGCACCACGCTTGCGCAGCGCACCCAGGGCAAATTCACCCTCGCTGGGCCGGATGGAACCCCCCAGCTGCGT
CTGGCGCAGGAACCCTTCGTCCAGCCGGGCTACGCGGATCTCAATCCATCCTATGAACAGGCCTCCAACGCCAGA
CCGGTCTGGTCGCTGGCCAAACCGTTGCCCCGTGTGGTGCGGCCGAGTATGGTGCCGACCAAAGATGAGCTCTTG
CAGAACATGGCGAATGCCCAGCGGCCCACGGAGAACTCGGATAGGTTGGGGCTGGACGTGGACCCGAACGATGTC
GAGCAGGGTCGCATTGATAAGACGTCCGATCCGCGGAAGATGGCTGCCCAGGTGAAGGACGCTCGGTTGCAGCGT
GAGAATACCTTTATGAGTAAGATTCTCAGTGGGGATGGCGGCAGCTCCATGAGACAGACTTCGCGCATGTCGCGT
TCGTCCTCGATCCCGGGGAGACGTACCTCGACATGGGATATGCCGCCGCCGGATCAACAACTGCCCACTGTAGAA
GAGGGTGATCATCCAGCCGAAGATGAACATGAACAAGAAGAGCGGCCGATGTCCGCTGACGAGCAGTTCCAGAAT
AATCAAGACATGGGTGCGCGATTGGACGAACTCTTATCGCTTCCCGAAATGGAAAAGGGGAATTACCCCGAAGAC
CTGCATCCGCTTGTCCAGGAACTGGTCGAAGACGAAGTGCACAACAACCACACCACTTGGTCCGTCGTCCGTACA
CACCACCGCGAGGCTCTCGCCGAGGGCCTGGGTGTGTTTGTTTCGCTCACCATGGGCTTCGCCATCGACGTGTCC
GTCACAGTCGCCGGCCAGGGTAACCCCAACACAACCGCCTGGGCCTGGGGCTTCGCAACCATGATCGGCATTTAC
ATTTCCGGTGGTGTCTCCGGTGCCCATCTCAACCCAGTCGTGACCATGGTATTGTGGTTCTTCCGTGGTTTCCCC
GCCCGCAAAATGCCCGAGTACTTAGCCGCGCAATTCATAGCCGCCTTTTGCGCGGGTCTCGTCGCGTACGGAATC
TACTACGAATCCATCCAGAACTACCTCCTCACCAACGCCGACACCGGAATCATCAACAGCTTTGTGACGAATCCG
CGAGAGTCGTGGGTGAGTCATACCACAGCGTTCTTCACCGAGTTCGTCGGGACCAGCTTTCTAATCGTCACCATT
CTGGCGCTGGGTGATGACCAGAACGCTCCCCCCGGTGCCGGTATGAACTCGCTGATCGTCGGCTTGGTCATTACG
TCCCTCCTCATGTGTTTCGCCTACCAGACCGGCGCGGCGTTCAACCCGAGCCGTGACTTTGGTCCGCGGCTTGCG
CTGCTCGCTTTCGGCTACCCGAACTCGATGTTCACGGACCCTTACTGGTTCTATGGGCCGTGGGTGGGGTGTGTC
GGAGGTGGGTTTTTCGGTGCGTTCCTATACGACTTCTTCATCTTCACCGGTGGTGAATCTCCCGTCAACTACCCG
CTTGAGCGCACCCAGCGCGCTTTGACGAAGAGTGCAATGAGGTGGAGGCGCCGACTGCGATTGAAACCGAAACAG
TGA
Transcript >Pro_DTO377G3_2|g8150.t1
ATGAGTGGGGGTCGTCCGAGGGCGAGATCCGATGCTCTGCCACAGTCACCGAACCGCAACCGAGCCGCCAGCGAT
GCAGATTATACCTCACCTAGGAGAACTACCTCACCCAGGAGAACTACCTCACCTCGGAGAACTTCCGCTGAGGAT
GGCGGCGTTCCTCGGCGATTCAACTCGAATACCTCGACGACACAAAGTAATGGTAGTGCACTACCCAGTTTGATC
CCGCGCACCACGCTTGCGCAGCGCACCCAGGGCAAATTCACCCTCGCTGGGCCGGATGGAACCCCCCAGCTGCGT
CTGGCGCAGGAACCCTTCGTCCAGCCGGGCTACGCGGATCTCAATCCATCCTATGAACAGGCCTCCAACGCCAGA
CCGGTCTGGTCGCTGGCCAAACCGTTGCCCCGTGTGGTGCGGCCGAGTATGGTGCCGACCAAAGATGAGCTCTTG
CAGAACATGGCGAATGCCCAGCGGCCCACGGAGAACTCGGATAGGTTGGGGCTGGACGTGGACCCGAACGATGTC
GAGCAGGGTCGCATTGATAAGACGTCCGATCCGCGGAAGATGGCTGCCCAGGTGAAGGACGCTCGGTTGCAGCGT
GAGAATACCTTTATGAGTAAGATTCTCAGTGGGGATGGCGGCAGCTCCATGAGACAGACTTCGCGCATGTCGCGT
TCGTCCTCGATCCCGGGGAGACGTACCTCGACATGGGATATGCCGCCGCCGGATCAACAACTGCCCACTGTAGAA
GAGGGTGATCATCCAGCCGAAGATGAACATGAACAAGAAGAGCGGCCGATGTCCGCTGACGAGCAGTTCCAGAAT
AATCAAGACATGGGTGCGCGATTGGACGAACTCTTATCGCTTCCCGAAATGGAAAAGGGGAATTACCCCGAAGAC
CTGCATCCGCTTGTCCAGGAACTGGTCGAAGACGAAGTGCACAACAACCACACCACTTGGTCCGTCGTCCGTACA
CACCACCGCGAGGCTCTCGCCGAGGGCCTGGGTGTGTTTGTTTCGCTCACCATGGGCTTCGCCATCGACGTGTCC
GTCACAGTCGCCGGCCAGGGTAACCCCAACACAACCGCCTGGGCCTGGGGCTTCGCAACCATGATCGGCATTTAC
ATTTCCGGTGGTGTCTCCGGTGCCCATCTCAACCCAGTCGTGACCATGGTATTGTGGTTCTTCCGTGGTTTCCCC
GCCCGCAAAATGCCCGAGTACTTAGCCGCGCAATTCATAGCCGCCTTTTGCGCGGGTCTCGTCGCGTACGGAATC
TACTACGAATCCATCCAGAACTACCTCCTCACCAACGCCGACACCGGAATCATCAACAGCTTTGTGACGAATCCG
CGAGAGTCGTGGGTGAGTCATACCACAGCGTTCTTCACCGAGTTCGTCGGGACCAGCTTTCTAATCGTCACCATT
CTGGCGCTGGGTGATGACCAGAACGCTCCCCCCGGTGCCGGTATGAACTCGCTGATCGTCGGCTTGGTCATTACG
TCCCTCCTCATGTGTTTCGCCTACCAGACCGGCGCGGCGTTCAACCCGAGCCGTGACTTTGGTCCGCGGCTTGCG
CTGCTCGCTTTCGGCTACCCGAACTCGATGTTCACGGACCCTTACTGGTTCTATGGGCCGTGGGTGGGGTGTGTC
GGAGGTGGGTTTTTCGGTGCGTTCCTATACGACTTCTTCATCTTCACCGGTGGTGAATCTCCCGTCAACTACCCG
CTTGAGCGCACCCAGCGCGCTTTGACGAAGAGTGCAATGAGGTGGAGGCGCCGACTGCGATTGAAACCGAAACAG
TGA
Gene >Pro_DTO377G3_2|g8150.t1
ATGAGTGGGGGTCGTCCGAGGGCGAGAGTAAGTCGGAGCAGAACTATCAGCTAAGAAACCACCATCTAACACCGT
TCCAGTCCGATGCTCTGCCACAGTCACCGAACCGCAACCGAGCCGCCAGCGATGCAGATTATACCTCACCTAGGA
GAACTACCTCACCCAGGAGAACTACCTCACCTCGGAGAACTTCCGCTGAGGATGGCGGCGTTCCTCGGCGATTCA
ACTCGAATACCTCGACGACACAAAGTAATGGTAGTGCACTACCCAGTTTGATCCCGCGCACCACGCTTGCGCAGC
GCACCCAGGGCAAATTCACCCTCGCTGGGCCGGATGGAACCCCCCAGCTGCGTCTGGCGCAGGAACCCTTCGTCC
AGCCGGGCTACGCGGATCTCAATCCATCCTATGAACAGGCCTCCAACGCCAGACCGGTCTGGTCGCTGGCCAAAC
CGTTGCCCCGTGTGGTGCGGCCGAGTATGGTGCCGACCAAAGATGAGCTCTTGCAGAACATGGCGAATGCCCAGC
GGCCCACGGAGAACTCGGATAGGTTGGGGCTGGACGTGGACCCGAACGATGTCGAGCAGGGTCGCATTGATAAGA
CGTCCGATCCGCGGAAGATGGCTGCCCAGGTGAAGGACGCTCGGTTGCAGCGTGAGAATACCTTTATGAGTAAGA
TTCTCAGTGGGGATGGCGGCAGCTCCATGAGACAGACTTCGCGCATGTCGCGTTCGTCCTCGATCCCGGGGAGAC
GTACCTCGACATGGGATATGCCGCCGCCGGATCAACAACTGCCCACTGTAGAAGAGGGTGATCATCCAGCCGAAG
ATGAACATGAACAAGAAGAGCGGCCGATGTCCGCTGACGAGCAGTTCCAGAATAATCAAGACATGGGTGCGCGAT
TGGACGAACTCTTATCGCTTCCCGAAATGGAAAAGGGGAATTACCCCGAAGACCTGCATCCGCTTGTCCAGGAAC
TGGTCGAAGACGAAGTGCACAACAACCACACCACTTGGTCCGTCGTCCGTACACACCACCGCGAGGCTCTCGCCG
AGGGCCTGGGTGTGTTTGTTTCGCTCACCATGGGCTTCGCCATCGACGTGTCCGTCACAGTCGCCGGCCAGGGTA
ACCCCAACACAACCGCCTGGGCCTGGGGCTTCGCAACCATGATCGGCATTTACATTTCCGGTGGTGTCTCCGGTG
CCCATCTCAACCCAGTCGTGACCATGGTATTGTGGTTCTTCCGTGGTTTCCCCGCCCGCAAAATGCCCGAGTACT
TAGCCGCGCAATTCATAGCCGCCTTTTGCGCGGGTCTCGTCGCGTACGGAATCTACTACGAATCCATCCAGAACT
ACCTCCTCACCAACGCCGACACCGGAATCATCAACAGCTTTGTGACGAATCCGCGAGAGTCGTGGGTGAGTCATA
CCACAGCGTTCTTCACCGAGTTCGTCGGGACCAGCTTTCTAATCGTCACCATTCTGGCGCTGGGTGATGACCAGA
ACGCTCCCCCCGGTGCCGGTATGAACTCGCTGATCGTCGGCTTGGTCATTACGTCCCTCCTCATGTGTTTCGCCT
ACCAGACCGGCGCGGCGTTCAACCCGAGCCGTGACTTTGGTCCGCGGCTTGCGCTGCTCGCTTTCGGCTACCCGA
ACTCGATGTTCACGGACCCTTACTGGTTCTATGGGCCGTGGGTGGGGTGTGTCGGAGGTGGGTTTTTCGGTGCGT
TCCTATACGACTTCTTCATCTTCACCGGTGGTGAATCTCCCGTCAACTACCCGCTTGAGCGCACCCAGCGCGCTT
TGACGAAGAGTGCAATGAGGTGGAGGCGCCGACTGCGATTGAAACCGAAACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail