Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8143.t1
Gene name
Locationscaffold_29:211914..212426
Strand-
Gene length (bp)512
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase 1.3E-22 21 102

GO

GO Term Description Terminal node
GO:0006729 tetrahydrobiopterin biosynthetic process Yes
GO:0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity Yes
GO:0051186 cofactor metabolic process No
GO:0009987 cellular process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0051188 cofactor biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0042559 pteridine-containing compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016829 lyase activity No
GO:0019751 polyol metabolic process No
GO:0046165 alcohol biosynthetic process No
GO:0006066 alcohol metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0042558 pteridine-containing compound metabolic process No
GO:0006732 coenzyme metabolic process No
GO:0016836 hydro-lyase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0017144 drug metabolic process No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0046146 tetrahydrobiopterin metabolic process No
GO:0034312 diol biosynthetic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0034311 diol metabolic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0046173 polyol biosynthetic process No
GO:0009108 coenzyme biosynthetic process No
GO:0018130 heterocycle biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8143.t1
MASSAFQFAEGEDAQQLAHDADALLQRGWAQDGDGMGVTKTFHFKSYFKAVAFVNMIAAESSSKKHHPTMTVRIG
SVDVHWTTHRPRGFTQKDVTMAQHCDKSADLMGAVDPGQGLKCGPTV*
Coding >Pro_DTO377G3_2|g8143.t1
ATGGCATCCAGCGCGTTTCAGTTCGCCGAGGGCGAGGATGCGCAGCAGCTTGCGCACGACGCCGACGCTTTATTG
CAGCGGGGCTGGGCGCAGGACGGAGACGGAATGGGGGTTACAAAAACGTTCCATTTTAAGAGTTATTTCAAGGCT
GTGGCGTTTGTTAATATGATTGCAGCCGAGAGTTCGTCCAAGAAACATCATCCCACTATGACTGTGCGGATTGGC
TCGGTCGATGTGCACTGGACAACCCATCGCCCTCGCGGGTTCACACAAAAAGATGTTACGATGGCGCAGCATTGT
GACAAGAGCGCTGATCTGATGGGCGCTGTTGATCCCGGCCAGGGACTGAAATGTGGTCCAACTGTCTAG
Transcript >Pro_DTO377G3_2|g8143.t1
ATGGCATCCAGCGCGTTTCAGTTCGCCGAGGGCGAGGATGCGCAGCAGCTTGCGCACGACGCCGACGCTTTATTG
CAGCGGGGCTGGGCGCAGGACGGAGACGGAATGGGGGTTACAAAAACGTTCCATTTTAAGAGTTATTTCAAGGCT
GTGGCGTTTGTTAATATGATTGCAGCCGAGAGTTCGTCCAAGAAACATCATCCCACTATGACTGTGCGGATTGGC
TCGGTCGATGTGCACTGGACAACCCATCGCCCTCGCGGGTTCACACAAAAAGATGTTACGATGGCGCAGCATTGT
GACAAGAGCGCTGATCTGATGGGCGCTGTTGATCCCGGCCAGGGACTGAAATGTGGTCCAACTGTCTAG
Gene >Pro_DTO377G3_2|g8143.t1
ATGGCATCCAGCGCGTTTCAGTTCGCCGAGGGCGAGGATGCGCAGCAGCTTGCGCACGACGCCGACGCTTTATTG
CAGCGGGGCTGGGCGCAGGACGGAGACGGAATGGGGGTTACAAAAACGTTCCATTTTAAGAGTTATTTCAAGGCT
GTGGTGAGTTGTGTCATTTGTCTGGACTGGGACTGCTTCCGCTCTGCTGTGAGACTGGTTTAACTGACAATCTCC
TCCGTCTAGGCGTTTGTTAATATGATTGCAGCCGAGAGTTCGTCCAAGAAACATCATCCCACTATGACTGTGGTA
AGTGGAACTTTTTGAGTTGGTGCCTCGAAAAAAAGAAATTAAGGCTGACGCCTCGTTAGCGGATTGGCTCGGTCG
ATGTGCACTGGACAACCCATCGCCCTCGCGGGTTCACACAAAAAGATGTTACGATGGCGCAGCATTGTGACAAGA
GCGCTGATCTGATGGGCGCTGTTGATCCCGGCCAGGGACTGAAATGTGGTCCAACTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail