Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8141.t1
Gene name
Locationscaffold_29:206968..208289
Strand+
Gene length (bp)1321
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03839 Sec62 Translocation protein Sec62 2.3E-71 141 329

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0015031 protein transport Yes
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0045184 establishment of protein localization No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0016021 integral component of membrane No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0051179 localization No
GO:0031301 integral component of organelle membrane No
GO:0031224 intrinsic component of membrane No
GO:0071705 nitrogen compound transport No
GO:0008104 protein localization No
GO:0110165 cellular anatomical entity No
GO:0033036 macromolecule localization No
GO:0009987 cellular process No
GO:0031300 intrinsic component of organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 244 266 22
2 279 301 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8141.t1
MATPGQPSPEQMAAMQQQFAAEAAKRGMTPQQFAAKQREQLTADATKLGLTTEQYVAQLRMRAMQAHQQQQKIQA
EQQAQAATEGQQAPSPAPQQHQHTTTQQVPVNPNNPPDPKAIAVANWLRSQNLKPRTCIMDGQRKDMFKVKRAIR
AIESPAYAKAASKKNSLLPPVTDRASAENVFKLLPLSLLALRVSKVDAHEGHNHAKPKNRTKGLWTVKIEQHQET
DPMMHYVWLYDGPQWKQKAMAAAVVAGIFAVVLFPLWPMIMRQGVWYLSVGMMGLLGLFFAMAIFRLILFCITVF
TVAPGLWLFPNLFEDVGFFDSFKPLWGWQETKKSKKASKSKTSASAPTPVAASAPAAPSAAPSENAPSATTTSAE
PTSTPSAVAPRRVLSASVEEAEE*
Coding >Pro_DTO377G3_2|g8141.t1
ATGGCCACCCCTGGCCAGCCCAGCCCTGAGCAGATGGCGGCGATGCAACAACAGTTCGCCGCCGAAGCCGCCAAA
CGAGGGATGACGCCCCAGCAGTTCGCCGCAAAGCAGCGTGAACAGCTGACTGCCGATGCTACAAAGCTCGGTCTG
ACTACTGAGCAATATGTTGCGCAGTTGCGCATGCGAGCAATGCAAGCCCACCAGCAGCAACAGAAAATCCAGGCC
GAACAACAGGCCCAAGCAGCAACAGAAGGACAACAAGCTCCGTCGCCCGCACCCCAGCAGCACCAACACACAACC
ACACAACAGGTCCCGGTGAACCCCAACAACCCCCCGGACCCAAAGGCAATAGCAGTGGCCAACTGGCTGCGGTCG
CAGAACCTCAAGCCACGCACATGTATCATGGACGGACAGCGCAAGGACATGTTCAAGGTCAAGCGCGCAATCCGA
GCCATTGAATCCCCCGCCTATGCCAAAGCCGCCTCAAAGAAGAACTCCCTCCTCCCCCCAGTGACCGACCGCGCC
TCCGCCGAGAACGTTTTCAAGCTTCTTCCACTTTCCCTTTTGGCTCTCCGAGTGAGCAAGGTTGATGCCCATGAA
GGCCACAACCATGCCAAGCCCAAGAATCGCACCAAGGGTCTATGGACCGTGAAGATCGAACAGCACCAAGAGACT
GACCCCATGATGCATTATGTTTGGTTGTATGACGGCCCGCAGTGGAAGCAAAAGGCCATGGCCGCTGCTGTGGTT
GCCGGTATCTTCGCCGTTGTCCTGTTCCCGTTGTGGCCTATGATTATGCGCCAGGGAGTGTGGTATTTGAGTGTT
GGTATGATGGGACTGTTGGGTCTCTTCTTCGCCATGGCTATCTTCCGTTTGATTCTATTCTGCATTACCGTCTTC
ACTGTGGCCCCGGGTCTCTGGCTATTCCCCAATCTGTTTGAGGATGTTGGGTTCTTCGATAGTTTCAAGCCTCTA
TGGGGCTGGCAAGAGACGAAAAAGAGCAAAAAGGCTAGCAAATCCAAGACCTCAGCCTCTGCTCCCACCCCAGTT
GCCGCGTCGGCCCCAGCTGCTCCCTCAGCTGCCCCTTCAGAAAACGCCCCTTCGGCAACCACAACCTCCGCCGAG
CCAACTTCTACCCCATCCGCAGTCGCACCGCGACGAGTTCTGAGCGCAAGTGTGGAAGAGGCGGAGGAGTAG
Transcript >Pro_DTO377G3_2|g8141.t1
ATGGCCACCCCTGGCCAGCCCAGCCCTGAGCAGATGGCGGCGATGCAACAACAGTTCGCCGCCGAAGCCGCCAAA
CGAGGGATGACGCCCCAGCAGTTCGCCGCAAAGCAGCGTGAACAGCTGACTGCCGATGCTACAAAGCTCGGTCTG
ACTACTGAGCAATATGTTGCGCAGTTGCGCATGCGAGCAATGCAAGCCCACCAGCAGCAACAGAAAATCCAGGCC
GAACAACAGGCCCAAGCAGCAACAGAAGGACAACAAGCTCCGTCGCCCGCACCCCAGCAGCACCAACACACAACC
ACACAACAGGTCCCGGTGAACCCCAACAACCCCCCGGACCCAAAGGCAATAGCAGTGGCCAACTGGCTGCGGTCG
CAGAACCTCAAGCCACGCACATGTATCATGGACGGACAGCGCAAGGACATGTTCAAGGTCAAGCGCGCAATCCGA
GCCATTGAATCCCCCGCCTATGCCAAAGCCGCCTCAAAGAAGAACTCCCTCCTCCCCCCAGTGACCGACCGCGCC
TCCGCCGAGAACGTTTTCAAGCTTCTTCCACTTTCCCTTTTGGCTCTCCGAGTGAGCAAGGTTGATGCCCATGAA
GGCCACAACCATGCCAAGCCCAAGAATCGCACCAAGGGTCTATGGACCGTGAAGATCGAACAGCACCAAGAGACT
GACCCCATGATGCATTATGTTTGGTTGTATGACGGCCCGCAGTGGAAGCAAAAGGCCATGGCCGCTGCTGTGGTT
GCCGGTATCTTCGCCGTTGTCCTGTTCCCGTTGTGGCCTATGATTATGCGCCAGGGAGTGTGGTATTTGAGTGTT
GGTATGATGGGACTGTTGGGTCTCTTCTTCGCCATGGCTATCTTCCGTTTGATTCTATTCTGCATTACCGTCTTC
ACTGTGGCCCCGGGTCTCTGGCTATTCCCCAATCTGTTTGAGGATGTTGGGTTCTTCGATAGTTTCAAGCCTCTA
TGGGGCTGGCAAGAGACGAAAAAGAGCAAAAAGGCTAGCAAATCCAAGACCTCAGCCTCTGCTCCCACCCCAGTT
GCCGCGTCGGCCCCAGCTGCTCCCTCAGCTGCCCCTTCAGAAAACGCCCCTTCGGCAACCACAACCTCCGCCGAG
CCAACTTCTACCCCATCCGCAGTCGCACCGCGACGAGTTCTGAGCGCAAGTGTGGAAGAGGCGGAGGAGTAG
Gene >Pro_DTO377G3_2|g8141.t1
ATGGCCACCCCTGGCCAGCCCAGCCCTGAGCAGATGGCGGCGATGCAACAACAGTTCGCCGCCGAAGCCGCCAAA
CGAGGGATGACGCCCCAGCAGTTCGCCGCAAAGCAGCGTGAACAGCTGACTGCCGATGCTACAAAGCTCGGTCTG
ACTACTGAGCAATATGTTGCGCAGTTGCGCATGCGAGCAATGCAAGCCCACCAGCAGCAACAGAAAATCCAGGCC
GAACAACAGGCCCAAGCAGCAACAGAAGGACAACAAGCTCCGTCGCCCGCACCCCAGCAGCACCAACACACAACC
ACACAACAGGTCCCGGTGAACCCCAACAACCCCCCGGACCCAAAGGCAATAGCAGTGGCCAACTGGCTGCGGTCG
CAGAACCTCAAGCCACGCACATGTATCATGGACGGACAGCGCAAGGACATGTTCAAGGGTGAGCGACCAAGATCT
AAATATTTCCGAGGAATCGCCATCTAACAGTGTTCATTCAATGTAGTCAAGCGCGCAATCCGAGCCATTGAATCC
CCCGCCTATGCCAAAGCCGCCTCAAAGAAGAACTCCCTCCTCCCCCCAGTGACCGACCGCGCCTCCGCCGAGAAC
GTTTTCAAGCTTCTTCCACTTTCCCTTTTGGCTCTCCGAGTGAGCAAGGTTGATGCCCATGAAGGCCACAACCAT
GCCAAGCCCAAGAATCGCACCAAGGGTCTATGGACCGTGAAGATCGAACAGCACCAAGAGACTGACCCCATGATG
CATTATGTTTGGTTGTATGACGGCCCGCAGTGGAAGCAAAAGGCCATGGCCGCTGCTGTGGTTGCCGGTATCTTC
GCCGTTGTCCTGTTCCCGTTGTGGCCTATGATTATGCGCCAGGGAGTGTGGTATTTGAGTGTTGGTATGATGGGA
CTGTTGGGTCTCTTCTTCGCCATGGCTATCTTCCGTTTGATTCTATTCTGCATTACCGTCTTCACTGTGGCCCCG
GGTCTCTGGCTATTCCCCAATCTGTTTGAGGATGTTGGGTTCTTCGATAGTTTCAAGCCTCTATGGGGCTGGCAA
GAGGTACGCATTTCTCTATTGACACATTTTCGGACATCGTAAAGCTGACTATTCAACCCTACAGACGAAAAAGAG
CAAAAAGGCTAGCAAATCCAAGACCTCAGCCTCTGCTCCCACCCCAGTTGCCGCGTCGGCCCCAGCTGCTCCCTC
AGCTGCCCCTTCAGAAAACGCCCCTTCGGCAACCACAACCTCCGCCGAGCCAACTTCTACCCCATCCGCAGTCGC
ACCGCGACGAGTTCTGAGCGCAAGTGTGGAAGAGGCGGAGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail