Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g814.t1
Gene name
Locationscaffold_01:2184336..2184847
Strand+
Gene length (bp)511
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain 3.0E-07 12 91
PF00149 Metallophos Calcineurin-like phosphoesterase 6.2E-07 12 90

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 16.57 4.46 28.68
5d_25C Five days - 25 degrees Celsius 16.81 4.48 29.14
7d_25C Seven days - 25 degrees Celsius 19.01 5.22 32.80
10d_25C Ten days - 25 degrees Celsius 18.93 5.08 32.77
7d_15C Seven days - 15 degrees Celsius 8.11 1.04 15.17
7d_30C Seven days - 30 degrees Celsius 20.86 6.25 35.47

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.983694 no
3d_25C 7d_25C 0.811075 no
3d_25C 7d_15C 0.123662 no
3d_25C 7d_30C 0.641857 no
3d_25C 10d_25C 0.818083 no
5d_25C 7d_25C 0.835659 no
5d_25C 7d_15C 0.117342 no
5d_25C 7d_30C 0.668111 no
5d_25C 10d_25C 0.842844 no
7d_25C 7d_15C 0.062295 no
7d_25C 7d_30C 0.875938 no
7d_25C 10d_25C 0.996401 no
7d_15C 7d_30C 0.032181 yes
7d_15C 10d_25C 0.063859 no
7d_30C 10d_25C 0.866273 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g814.t1
MSESASANVKTRFLVFSDTHGLDTPPNFVSRHYADVAIHCGDLTTESKIDEYKASIRFLQAVNAPLKLVIAGNHD
FTLDTPMFQKKVAEAQPLDPQLVQKVYGNYEEARGLFEKETDITFLDEARTPHHLGIGGFNITPSADMTFELRMS
MS*
Coding >Pro_DTO377G3_2|g814.t1
ATGTCAGAGAGTGCATCAGCGAATGTGAAAACTAGATTCCTGGTTTTTTCCGACACACATGGGCTTGATACTCCA
CCAAACTTTGTCTCGCGCCATTATGCGGATGTCGCAATTCACTGCGGAGATCTCACTACCGAATCGAAAATCGAT
GAGTACAAAGCTTCGATCCGTTTCCTCCAAGCCGTGAACGCCCCGCTTAAACTTGTGATCGCCGGTAATCATGAC
TTCACTCTGGACACTCCAATGTTCCAGAAAAAGGTCGCGGAAGCCCAACCCTTAGATCCTCAACTAGTTCAAAAA
GTCTACGGCAACTATGAAGAAGCTCGAGGGTTATTCGAGAAAGAAACAGATATCACTTTTCTAGATGAAGCCCGT
ACACCCCATCACTTGGGGATTGGGGGTTTCAATATCACCCCGAGCGCGGACATGACTTTCGAATTGAGAATGTCG
ATGTCGTGA
Transcript >Pro_DTO377G3_2|g814.t1
ATGTCAGAGAGTGCATCAGCGAATGTGAAAACTAGATTCCTGGTTTTTTCCGACACACATGGGCTTGATACTCCA
CCAAACTTTGTCTCGCGCCATTATGCGGATGTCGCAATTCACTGCGGAGATCTCACTACCGAATCGAAAATCGAT
GAGTACAAAGCTTCGATCCGTTTCCTCCAAGCCGTGAACGCCCCGCTTAAACTTGTGATCGCCGGTAATCATGAC
TTCACTCTGGACACTCCAATGTTCCAGAAAAAGGTCGCGGAAGCCCAACCCTTAGATCCTCAACTAGTTCAAAAA
GTCTACGGCAACTATGAAGAAGCTCGAGGGTTATTCGAGAAAGAAACAGATATCACTTTTCTAGATGAAGCCCGT
ACACCCCATCACTTGGGGATTGGGGGTTTCAATATCACCCCGAGCGCGGACATGACTTTCGAATTGAGAATGTCG
ATGTCGTGA
Gene >Pro_DTO377G3_2|g814.t1
ATGTCAGAGAGTGCATCAGCGAATGTGAAAACTAGATTCCTGGTTTTTTCCGACACACATGGGCTTGATACTCCA
CCAAACTTTGTCTCGCGCCATTATGCGGATGTCGCAATTCACTGCGGAGATCTCACTACCGAATCGAAAATCGAT
GAGTACAAAGCTTCGATCCGTTTCCTCCAAGCCGTGAACGCCCCGCTTAAACTTGTGATCGCCGGTAATCATGAC
TTCACTCTGGACACTCCAATGTTCCAGAAAAAGGTCGCGGAAGCCCAACCCTTAGATCCTCAACTAGTTCAAAAA
GTCTACGGCAACTATGAAGAAGCTCGAGGGTTATTCGAGAAAGAAACAGATATCACTTTTCTAGATGAAGGTATC
CATTCCTTTCGCTTACAAAATGGTGCTCTATTGAATGTTTATGCTAGCCCGTACACCCCATCACTTGGGGATTGG
GGGTTTCAATATCACCCCGAGCGCGGACATGACTTTCGAATTGAGAATGTCGATGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail