Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8109.t1
Gene name
Locationscaffold_29:115662..117441
Strand+
Gene length (bp)1779
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01556 DnaJ_C DnaJ C terminal domain 6.6E-36 225 454
PF00226 DnaJ DnaJ domain 2.9E-22 83 144
PF00684 DnaJ_CXXCXGXG DnaJ central domain 2.7E-09 252 315

GO

GO Term Description Terminal node
GO:0051082 unfolded protein binding Yes
GO:0031072 heat shock protein binding Yes
GO:0005515 protein binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 86.25 52.95 119.56
5d_25C Five days - 25 degrees Celsius 115.06 70.10 160.03
7d_25C Seven days - 25 degrees Celsius 130.21 78.54 181.88
10d_25C Ten days - 25 degrees Celsius 178.06 106.11 250.01
7d_15C Seven days - 15 degrees Celsius 153.59 90.23 216.96
7d_30C Seven days - 30 degrees Celsius 90.32 55.00 125.64

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.200400 no
3d_25C 7d_25C 0.049955 yes
3d_25C 7d_15C 0.003197 yes
3d_25C 7d_30C 0.885448 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.655286 no
5d_25C 7d_15C 0.216420 no
5d_25C 7d_30C 0.301878 no
5d_25C 10d_25C 0.041603 yes
7d_25C 7d_15C 0.545491 no
7d_25C 7d_30C 0.092657 no
7d_25C 10d_25C 0.182308 no
7d_15C 7d_30C 0.010735 yes
7d_15C 10d_25C 0.598319 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8109.t1
MNPSTAFPKAAAFPARLLRTQRQCSKQTSGNSVHSSTQTRNYHATVSASPARSFREGVCKRKESLVISARAFHTT
SPLAAVPDPYKVLGVDKKASAGDIKKAYYGLAKKYHPDTNKDAQAKDKFAEAQTAYELLSDAQKRENYDRYGSAA
FDQNGGFNPNAGGSPFSGAGGFHGFGGGASGGFGGGFSGDINFEDLFGAFTGGARRGPRGGRNPFQEQILVGEDI
EVQTNISFMDAAKGTSQEIVITPLTKCGTCKGDGLKSGAKRSQCRQCNGTGTRVHLMQGGFQVAATCDACGGSGM
SVPRGSECGSCNGHGVVRERKTIKIDIPGGVEDGMRLRVTGEGDSPPTGTAVPPGARTQPGDLYVSIRVAPDHRF
SRSGSDILYTASIPLTTAILGGEVTIPTLDNQVKVKVATGTGTGDRITLSGMGMKKLNGRARGFTPNGDLKVEFK
VAMPKYLTGNQRTILEVLADEMNDKTAKRTMNFNKDSPFSTSSSAEDAAKNEGFLKSVWHRLTEKHDDGSKPSQA
DSKDSNKDTEKKDADDSSKDSSKKSS*
Coding >Pro_DTO377G3_2|g8109.t1
ATGAATCCATCCACGGCATTTCCCAAGGCCGCGGCTTTCCCGGCGCGCCTGCTGCGGACCCAGCGACAGTGCTCT
AAGCAGACTTCCGGCAATAGCGTTCACTCATCTACGCAAACAAGAAATTACCATGCCACTGTCTCTGCTTCTCCG
GCTAGGAGTTTCCGGGAGGGCGTTTGCAAGAGAAAAGAATCTTTGGTGATATCGGCTAGGGCCTTCCACACTACA
TCTCCTCTTGCGGCTGTTCCCGACCCTTACAAGGTCCTCGGTGTGGATAAGAAAGCATCCGCCGGCGACATAAAG
AAGGCCTACTACGGCTTGGCCAAGAAGTACCACCCGGATACCAATAAGGATGCCCAGGCCAAAGACAAGTTTGCC
GAAGCCCAGACAGCATATGAACTGTTATCTGACGCCCAGAAGCGAGAGAACTATGACCGGTATGGTTCAGCCGCT
TTCGATCAGAATGGCGGGTTCAATCCAAACGCTGGCGGCAGCCCATTCTCTGGTGCGGGAGGATTCCATGGCTTT
GGTGGTGGTGCCAGTGGTGGCTTTGGCGGCGGATTTTCTGGCGACATCAACTTTGAGGATCTTTTCGGAGCCTTT
ACCGGAGGAGCGCGGCGTGGACCCCGAGGTGGGCGTAACCCATTCCAAGAACAAATTTTGGTTGGCGAAGATATT
GAGGTGCAAACAAACATCTCGTTCATGGATGCTGCGAAGGGCACGTCTCAGGAAATTGTCATCACGCCGTTAACC
AAGTGCGGAACCTGCAAAGGTGACGGATTGAAGTCTGGTGCCAAACGGTCCCAATGTCGTCAGTGCAACGGCACA
GGTACCCGCGTTCATCTCATGCAGGGAGGCTTCCAAGTCGCCGCCACCTGTGACGCTTGTGGAGGTTCGGGTATG
TCTGTTCCCCGGGGATCAGAGTGCGGCTCCTGCAACGGACATGGCGTTGTCCGAGAGCGCAAGACCATCAAGATA
GACATCCCCGGCGGTGTCGAAGACGGCATGCGTCTGCGAGTGACCGGTGAAGGTGACTCCCCGCCAACTGGAACG
GCTGTTCCCCCTGGTGCTCGCACCCAGCCCGGTGATCTTTACGTCTCCATTCGAGTTGCTCCAGACCATCGCTTC
AGCCGCTCCGGGTCCGACATTCTATATACAGCCTCCATTCCCCTCACCACTGCTATCCTTGGTGGCGAGGTGACT
ATCCCAACTCTCGACAATCAAGTGAAGGTCAAGGTGGCCACCGGTACGGGTACCGGTGACCGGATCACTTTGTCA
GGAATGGGCATGAAGAAACTTAATGGCCGTGCTCGCGGTTTCACTCCCAATGGCGATCTCAAGGTCGAATTCAAG
GTTGCTATGCCTAAGTACCTGACGGGCAATCAGCGCACCATTTTGGAGGTCCTTGCAGACGAGATGAACGATAAG
ACAGCGAAGCGGACAATGAATTTCAACAAGGATAGCCCCTTCTCTACCTCCAGTAGTGCTGAAGATGCCGCCAAG
AACGAAGGTTTCCTGAAGTCTGTATGGCATCGACTCACGGAGAAGCATGATGATGGCTCCAAGCCATCCCAGGCT
GACTCTAAAGACTCCAACAAGGACACAGAAAAGAAGGATGCTGACGATAGCAGCAAGGATAGCTCGAAGAAGTCG
AGCTGA
Transcript >Pro_DTO377G3_2|g8109.t1
ATGAATCCATCCACGGCATTTCCCAAGGCCGCGGCTTTCCCGGCGCGCCTGCTGCGGACCCAGCGACAGTGCTCT
AAGCAGACTTCCGGCAATAGCGTTCACTCATCTACGCAAACAAGAAATTACCATGCCACTGTCTCTGCTTCTCCG
GCTAGGAGTTTCCGGGAGGGCGTTTGCAAGAGAAAAGAATCTTTGGTGATATCGGCTAGGGCCTTCCACACTACA
TCTCCTCTTGCGGCTGTTCCCGACCCTTACAAGGTCCTCGGTGTGGATAAGAAAGCATCCGCCGGCGACATAAAG
AAGGCCTACTACGGCTTGGCCAAGAAGTACCACCCGGATACCAATAAGGATGCCCAGGCCAAAGACAAGTTTGCC
GAAGCCCAGACAGCATATGAACTGTTATCTGACGCCCAGAAGCGAGAGAACTATGACCGGTATGGTTCAGCCGCT
TTCGATCAGAATGGCGGGTTCAATCCAAACGCTGGCGGCAGCCCATTCTCTGGTGCGGGAGGATTCCATGGCTTT
GGTGGTGGTGCCAGTGGTGGCTTTGGCGGCGGATTTTCTGGCGACATCAACTTTGAGGATCTTTTCGGAGCCTTT
ACCGGAGGAGCGCGGCGTGGACCCCGAGGTGGGCGTAACCCATTCCAAGAACAAATTTTGGTTGGCGAAGATATT
GAGGTGCAAACAAACATCTCGTTCATGGATGCTGCGAAGGGCACGTCTCAGGAAATTGTCATCACGCCGTTAACC
AAGTGCGGAACCTGCAAAGGTGACGGATTGAAGTCTGGTGCCAAACGGTCCCAATGTCGTCAGTGCAACGGCACA
GGTACCCGCGTTCATCTCATGCAGGGAGGCTTCCAAGTCGCCGCCACCTGTGACGCTTGTGGAGGTTCGGGTATG
TCTGTTCCCCGGGGATCAGAGTGCGGCTCCTGCAACGGACATGGCGTTGTCCGAGAGCGCAAGACCATCAAGATA
GACATCCCCGGCGGTGTCGAAGACGGCATGCGTCTGCGAGTGACCGGTGAAGGTGACTCCCCGCCAACTGGAACG
GCTGTTCCCCCTGGTGCTCGCACCCAGCCCGGTGATCTTTACGTCTCCATTCGAGTTGCTCCAGACCATCGCTTC
AGCCGCTCCGGGTCCGACATTCTATATACAGCCTCCATTCCCCTCACCACTGCTATCCTTGGTGGCGAGGTGACT
ATCCCAACTCTCGACAATCAAGTGAAGGTCAAGGTGGCCACCGGTACGGGTACCGGTGACCGGATCACTTTGTCA
GGAATGGGCATGAAGAAACTTAATGGCCGTGCTCGCGGTTTCACTCCCAATGGCGATCTCAAGGTCGAATTCAAG
GTTGCTATGCCTAAGTACCTGACGGGCAATCAGCGCACCATTTTGGAGGTCCTTGCAGACGAGATGAACGATAAG
ACAGCGAAGCGGACAATGAATTTCAACAAGGATAGCCCCTTCTCTACCTCCAGTAGTGCTGAAGATGCCGCCAAG
AACGAAGGTTTCCTGAAGTCTGTATGGCATCGACTCACGGAGAAGCATGATGATGGCTCCAAGCCATCCCAGGCT
GACTCTAAAGACTCCAACAAGGACACAGAAAAGAAGGATGCTGACGATAGCAGCAAGGATAGCTCGAAGAAGTCG
AGCTGA
Gene >Pro_DTO377G3_2|g8109.t1
ATGAATCCATCCACGGCATTTCCCAAGGCCGCGGCTTTCCCGGCGCGCCTGCTGCGGACCCAGCGACAGTGCTCT
AAGCAGACTTCCGGCAATAGCGTTCACTCATCTACGCAAACAAGAAATTACCATGCCACTGTCTCTGCTTCTCCG
GCTAGGAGTTTCCGGGAGGGCGTTTGCAAGAGAAAAGAATCTTTGGTGATATCGGCTAGGGTATGTCGTCTCTAC
GGACTGTCAGGGTTCGGGTTGCTAATAACATATTTTTTTTTTATCGACAGGCCTTCCACACTACATCTCCTCTTG
CGGCTGTTCCCGACCCTTACAAGGTCCTCGGTGTGGATAAGAAAGCATCCGCCGGCGACATAAAGAAGGCCTACT
ACGGCTTGGCCAAGAAGTACCACCCGGATACCAATAAGGATGCCCAGGCCAAAGACAAGTTTGCCGAAGCCCAGA
CAGCATATGAACTGTTATCTGACGCCCAGAAGCGAGAGAACTATGACCGGTATGGTTCAGCCGCTTTCGATCAGA
ATGGCGGGTTCAATCCAAACGCTGGCGGCAGCCCATTCTCTGGTGCGGGAGGATTCCATGGCTTTGGTGGTGGTG
CCAGTGGTGGCTTTGGCGGCGGATTTTCTGGCGACATCAACTTTGAGGATCTTTTCGGAGCCTTTACCGGAGGAG
CGCGGCGTGGACCCCGAGGTGGGCGTAACCCATTCCAAGAACAAATTTTGGTTGGCGAAGATATTGAGGTGCAAA
CAAACATCTCGTTCATGGATGCTGCGAAGGGCACGTCTCAGGAAATTGTCATCACGCCGTTAACCAAGTGCGGAA
CCTGCAAAGGTGACGGATTGAAGTCTGGTGCCAAACGGTCCCAATGTCGTCAGTGCAACGGCACAGGTACCCGCG
TTCATCTCATGCAGGGAGGCTTCCAAGTCGCCGCCACCTGTGACGCTTGTGGAGGTTCGGGTATGTCTGTTCCCC
GGGGATCAGAGTGCGGCTCCTGCAACGGACATGGCGTTGTCCGAGAGCGCAAGACCATCAAGATAGACATCCCCG
GCGGTGTCGAAGACGGCATGCGTCTGCGAGTGACCGGTGAAGGTGACTCCCCGCCAACTGGAACGGCTGTTCCCC
CTGGTGCTCGCACCCAGCCCGGTGATCTTTACGTCTCCATTCGAGTTGCTCCAGACCATCGCTTCAGCCGCTCCG
GGTCCGACATTCTATATACAGCCTCCATTCCCCTCACCACTGCTATCCTTGGTGGCGAGGTGACTATCCCAACTC
TCGACAATCAAGTGAAGGTCAAGGTGGCCACCGGTACGGGTACCGGTGACCGGATCACTTTGTCAGGAATGGGCA
TGAAGAAACTTAATGGCCGTGCTCGCGGTTTCACTCCCAATGGCGATCTCAAGGTCGAATTCAAGGTTGCTATGC
CTAAGTACCTGACGGGCAATCAGCGCACCATTTTGGAGGTCCTTGCAGACGAGATGAACGATAAGACAGCGAAGC
GGACAATGAATTTCAACAAGGATAGGTAAGATGCACAGTTCGTCGTGGATATTGGCTTTTGTACTAATTGACTAC
ACTTGTAGCCCCTTCTCTACCTCCAGTAGTGCTGAAGATGCCGCCAAGAACGAAGGTTTCCTGAAGTCTGTATGG
CATCGACTCACGGAGAAGCATGATGATGGCTCCAAGCCATCCCAGGCTGACTCTAAAGACTCCAACAAGGACACA
GAAAAGAAGGATGCTGACGATAGCAGCAAGGATAGCTCGAAGAAGTCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail