Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8108.t1
Gene name
Locationscaffold_29:111781..115249
Strand-
Gene length (bp)3468
Transcript length (bp)3351
Coding sequence length (bp)3351
Protein length (aa) 1117

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05362 Lon_C Lon protease (S16) C-terminal proteolytic domain 7.0E-64 881 1086
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 1.0E-32 203 459
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.9E-21 610 746
PF07728 AAA_5 AAA domain (dynein-related subfamily) 4.4E-07 610 704
PF07724 AAA_2 AAA domain (Cdc48 subfamily) 1.4E-05 611 736
PF08298 AAA_PrkA PrkA AAA domain 1.6E-05 574 633

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0004176 ATP-dependent peptidase activity Yes
GO:0017171 serine hydrolase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0016462 pyrophosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0140096 catalytic activity, acting on a protein No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0019538 protein metabolic process No
GO:0005488 binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0008233 peptidase activity No
GO:0008236 serine-type peptidase activity No
GO:0042623 ATPase activity, coupled No
GO:0006807 nitrogen compound metabolic process No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0004175 endopeptidase activity No
GO:0008152 metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8108.t1
MLRGQTLPWRAVLHQTPRPLLRRPFLASPRYNATFRSTLISARFGASLPSSSRAFSASSIRRREKPPPEDPKEES
EEKEEDETSHDDKGTERAPEPRKKGADSGKHVPSADQVAPARRKDRSSDKERGVEEEVKKEANASDSKGNSNDTP
SPIPPSDGPADSKPSGASSGGHGGNDDSGKKGKKASGEKALQKPAVPDVYPQVMAIPIAKRPLFPGFYKAITIRD
PNVAAAIQDMMKRGQPYVGAFLFKDDNADGDVIEKLDDVYDTGVFAQITAAYPLRGESSGVTAVLYPHRRIKISS
LLPPGEHTKAATPPPAPTSEDKTTEKRGDVVASFEEGAPEPTPKDHYEPTSFLKKYPVSLVNVENLTEEPFDKKN
PIIRAVTSEIVNVCKEIATLNPLFRDQISAFYTDQFPGNLSDEPAKLADFAAAVSAGELHEMQEVLETMNIEERL
PKALVVLKKELMNAQLQSKITKDVEAKIQKRQREYWLMEQMKGIKRELGIESDGKDKLVEKFKEKAEKLAMPEVV
KKVFDEEINKLAHLEPAASEFNVTRNYLDWLTQIPWGQKSVENFGVKNAVSVLDEDHYGLKDVKDRILEFIAVGK
LRGTVEGKILCLVGPPGVGKTSIGKSIARALNRQYYRFSVGGLTDVAEIKGHRRTYVGALPGRIIQALKKCQTEN
PLILIDEVDKIGRGHQGDPSSALLELLDPEQNNSFLDHYMDVPVDLSKVLFVCTANVTDTIPRPLLDRMELIELS
GYVADEKMAIAEKYLAPAARELTGLKDVDVNLERDAIEELIKSYCRESGVRNLKKQIEKVYRKAAFKIVQDLGED
VLPEEAALTEAGKAAQEESKEHEPADPAQVPVEPEKSTTEIPRLALKVPDTVHLSIGKGTLKDYVGPPVFTSDRL
YDQFPPGVTMGLAWTSMGGAALYVECILENALNHNSRPGLEITGNLQNVMKESTHIAYSFAKSVMARQFPENRFF
EKAKVHLHCPEGAVPKDGPSAGITMASALLSLALNHSLEPTVAMTGELTVTGKVLRIGGLREKTVAARRAGATKV
LFPADNTSDWLELPENIKEGIEGHPVNWYSEVFDLLFPTLDQEAARTVWQKALAKPKKESHEVEEE*
Coding >Pro_DTO377G3_2|g8108.t1
ATGCTCCGCGGCCAGACCCTCCCCTGGAGAGCTGTACTCCATCAAACGCCACGACCTCTCCTCCGACGGCCGTTT
CTTGCATCACCGAGATATAATGCAACATTCCGATCAACACTAATTTCGGCCCGCTTCGGTGCCTCTCTTCCGTCG
TCTTCCCGCGCCTTCTCTGCAAGCTCCATTCGGCGTAGAGAGAAACCCCCGCCAGAGGACCCTAAAGAGGAATCG
GAAGAAAAGGAAGAGGACGAAACCAGTCACGATGATAAGGGAACGGAACGGGCACCTGAACCGCGGAAGAAGGGA
GCCGATTCAGGGAAGCATGTCCCTTCCGCAGATCAGGTAGCTCCCGCGCGGAGAAAAGACCGGTCATCCGATAAA
GAGCGCGGAGTGGAAGAGGAAGTCAAGAAAGAAGCCAATGCATCAGATAGCAAGGGGAACTCGAATGACACACCT
TCGCCCATCCCACCAAGTGATGGTCCGGCCGACTCCAAGCCTAGCGGCGCAAGCAGCGGCGGTCATGGCGGCAAC
GATGATAGCGGGAAGAAGGGCAAGAAGGCCTCCGGGGAAAAGGCTTTACAAAAGCCGGCAGTTCCCGACGTTTAC
CCACAGGTGATGGCAATTCCCATCGCGAAACGCCCGTTGTTCCCCGGTTTTTACAAAGCGATCACTATTCGCGAC
CCAAATGTCGCCGCTGCGATCCAGGATATGATGAAACGGGGTCAGCCGTATGTCGGAGCGTTCTTGTTCAAGGAT
GACAACGCGGATGGTGACGTGATTGAGAAATTGGACGACGTTTATGACACCGGAGTTTTCGCTCAAATCACCGCC
GCATATCCTCTTCGTGGAGAGTCAAGCGGTGTGACAGCGGTTCTTTATCCCCACCGGCGTATCAAGATCTCGTCG
CTACTTCCCCCCGGAGAGCATACCAAGGCCGCTACACCTCCACCCGCACCTACGTCAGAAGACAAGACGACCGAA
AAGCGAGGTGATGTCGTGGCCAGCTTCGAAGAAGGCGCACCCGAGCCAACTCCCAAAGACCATTACGAACCTACA
TCCTTCCTGAAAAAATACCCTGTCAGCCTTGTCAACGTGGAAAACTTGACCGAAGAGCCGTTCGACAAGAAAAAT
CCAATTATCCGCGCGGTAACCAGTGAAATTGTCAATGTGTGCAAAGAGATCGCCACCTTGAATCCTTTATTCCGC
GACCAAATCTCGGCATTCTACACCGATCAATTTCCAGGAAATCTCAGCGACGAACCGGCGAAATTGGCTGATTTC
GCTGCCGCTGTATCTGCCGGTGAGCTCCACGAGATGCAAGAAGTTCTTGAGACAATGAATATCGAGGAGCGTCTC
CCCAAGGCACTTGTTGTTCTAAAGAAAGAATTGATGAACGCTCAACTGCAATCCAAGATTACCAAAGATGTCGAG
GCCAAGATCCAGAAGCGCCAGCGCGAGTACTGGCTGATGGAGCAAATGAAGGGCATCAAGAGAGAACTTGGTATC
GAGTCCGACGGGAAAGACAAGCTTGTCGAGAAGTTCAAGGAGAAGGCCGAAAAGCTTGCCATGCCCGAGGTCGTC
AAGAAGGTCTTCGACGAGGAGATCAACAAGCTGGCACACCTCGAGCCCGCTGCATCCGAGTTCAACGTCACTCGT
AACTACCTAGACTGGCTAACTCAAATCCCCTGGGGCCAGAAGAGCGTGGAAAATTTTGGCGTCAAGAACGCAGTC
AGTGTTCTCGATGAGGATCATTACGGGTTGAAGGATGTCAAGGATCGTATTCTTGAGTTCATCGCTGTCGGCAAG
CTTCGTGGAACTGTCGAAGGCAAGATTCTGTGCCTTGTTGGCCCACCCGGTGTTGGAAAGACCAGTATCGGCAAG
TCCATAGCTCGCGCTCTGAACAGACAATACTACCGATTCTCCGTTGGTGGTTTGACCGACGTGGCAGAGATCAAG
GGCCACCGACGGACTTACGTTGGTGCTCTGCCTGGCCGCATTATCCAAGCTCTCAAGAAGTGTCAAACCGAAAAC
CCTTTAATCTTGATCGACGAGGTTGACAAGATTGGGCGTGGTCACCAGGGCGATCCGTCCTCTGCTTTGCTTGAA
CTTCTTGACCCCGAACAAAATAACTCGTTCTTAGACCACTACATGGATGTTCCTGTGGATCTTTCCAAGGTCCTC
TTCGTCTGTACAGCCAACGTGACTGACACTATCCCTCGGCCATTGTTGGATCGTATGGAACTAATCGAATTGTCC
GGCTACGTGGCAGACGAGAAGATGGCAATTGCTGAGAAATACCTCGCCCCCGCCGCTCGGGAGCTGACTGGTCTG
AAGGATGTGGATGTGAACCTTGAACGGGATGCCATCGAGGAGCTGATCAAGTCGTATTGCCGTGAGAGCGGTGTC
CGTAACCTGAAGAAGCAAATCGAAAAAGTCTATCGGAAGGCAGCTTTCAAGATTGTCCAAGACCTAGGCGAGGAT
GTGCTGCCCGAAGAGGCGGCACTTACTGAAGCGGGCAAGGCTGCTCAGGAGGAGTCAAAGGAACATGAGCCAGCC
GATCCTGCGCAAGTTCCGGTCGAGCCGGAGAAGTCGACCACAGAGATCCCTCGACTGGCTCTCAAGGTTCCCGAC
ACTGTGCATCTCAGCATCGGCAAGGGAACCTTGAAGGATTACGTTGGACCTCCTGTTTTCACATCCGACCGCCTG
TACGACCAGTTCCCTCCTGGTGTCACCATGGGTCTTGCATGGACCAGCATGGGTGGAGCGGCTCTGTACGTTGAA
TGTATCCTGGAGAACGCATTGAATCACAACTCGCGCCCCGGGCTCGAAATCACCGGCAACCTGCAAAACGTGATG
AAGGAGTCCACCCACATTGCGTATTCATTCGCTAAGTCTGTAATGGCGCGACAATTCCCCGAGAACCGGTTCTTC
GAAAAAGCCAAGGTCCACTTGCACTGCCCCGAAGGCGCTGTCCCAAAGGATGGACCCTCTGCCGGTATCACCATG
GCTAGCGCCTTGTTGTCTTTGGCTTTGAACCACTCCCTTGAGCCAACCGTTGCCATGACCGGAGAGTTGACTGTA
ACTGGTAAGGTTCTGCGCATTGGAGGCTTGAGAGAGAAGACTGTGGCTGCCCGTCGGGCTGGTGCCACAAAAGTC
CTCTTCCCCGCGGACAACACATCTGACTGGCTTGAGCTACCTGAGAACATCAAGGAGGGCATTGAAGGCCACCCG
GTGAACTGGTACTCCGAAGTGTTTGACCTTCTCTTCCCCACTCTCGACCAGGAGGCTGCCCGTACTGTCTGGCAA
AAAGCATTGGCCAAGCCTAAGAAGGAGAGCCACGAGGTCGAGGAAGAGTAG
Transcript >Pro_DTO377G3_2|g8108.t1
ATGCTCCGCGGCCAGACCCTCCCCTGGAGAGCTGTACTCCATCAAACGCCACGACCTCTCCTCCGACGGCCGTTT
CTTGCATCACCGAGATATAATGCAACATTCCGATCAACACTAATTTCGGCCCGCTTCGGTGCCTCTCTTCCGTCG
TCTTCCCGCGCCTTCTCTGCAAGCTCCATTCGGCGTAGAGAGAAACCCCCGCCAGAGGACCCTAAAGAGGAATCG
GAAGAAAAGGAAGAGGACGAAACCAGTCACGATGATAAGGGAACGGAACGGGCACCTGAACCGCGGAAGAAGGGA
GCCGATTCAGGGAAGCATGTCCCTTCCGCAGATCAGGTAGCTCCCGCGCGGAGAAAAGACCGGTCATCCGATAAA
GAGCGCGGAGTGGAAGAGGAAGTCAAGAAAGAAGCCAATGCATCAGATAGCAAGGGGAACTCGAATGACACACCT
TCGCCCATCCCACCAAGTGATGGTCCGGCCGACTCCAAGCCTAGCGGCGCAAGCAGCGGCGGTCATGGCGGCAAC
GATGATAGCGGGAAGAAGGGCAAGAAGGCCTCCGGGGAAAAGGCTTTACAAAAGCCGGCAGTTCCCGACGTTTAC
CCACAGGTGATGGCAATTCCCATCGCGAAACGCCCGTTGTTCCCCGGTTTTTACAAAGCGATCACTATTCGCGAC
CCAAATGTCGCCGCTGCGATCCAGGATATGATGAAACGGGGTCAGCCGTATGTCGGAGCGTTCTTGTTCAAGGAT
GACAACGCGGATGGTGACGTGATTGAGAAATTGGACGACGTTTATGACACCGGAGTTTTCGCTCAAATCACCGCC
GCATATCCTCTTCGTGGAGAGTCAAGCGGTGTGACAGCGGTTCTTTATCCCCACCGGCGTATCAAGATCTCGTCG
CTACTTCCCCCCGGAGAGCATACCAAGGCCGCTACACCTCCACCCGCACCTACGTCAGAAGACAAGACGACCGAA
AAGCGAGGTGATGTCGTGGCCAGCTTCGAAGAAGGCGCACCCGAGCCAACTCCCAAAGACCATTACGAACCTACA
TCCTTCCTGAAAAAATACCCTGTCAGCCTTGTCAACGTGGAAAACTTGACCGAAGAGCCGTTCGACAAGAAAAAT
CCAATTATCCGCGCGGTAACCAGTGAAATTGTCAATGTGTGCAAAGAGATCGCCACCTTGAATCCTTTATTCCGC
GACCAAATCTCGGCATTCTACACCGATCAATTTCCAGGAAATCTCAGCGACGAACCGGCGAAATTGGCTGATTTC
GCTGCCGCTGTATCTGCCGGTGAGCTCCACGAGATGCAAGAAGTTCTTGAGACAATGAATATCGAGGAGCGTCTC
CCCAAGGCACTTGTTGTTCTAAAGAAAGAATTGATGAACGCTCAACTGCAATCCAAGATTACCAAAGATGTCGAG
GCCAAGATCCAGAAGCGCCAGCGCGAGTACTGGCTGATGGAGCAAATGAAGGGCATCAAGAGAGAACTTGGTATC
GAGTCCGACGGGAAAGACAAGCTTGTCGAGAAGTTCAAGGAGAAGGCCGAAAAGCTTGCCATGCCCGAGGTCGTC
AAGAAGGTCTTCGACGAGGAGATCAACAAGCTGGCACACCTCGAGCCCGCTGCATCCGAGTTCAACGTCACTCGT
AACTACCTAGACTGGCTAACTCAAATCCCCTGGGGCCAGAAGAGCGTGGAAAATTTTGGCGTCAAGAACGCAGTC
AGTGTTCTCGATGAGGATCATTACGGGTTGAAGGATGTCAAGGATCGTATTCTTGAGTTCATCGCTGTCGGCAAG
CTTCGTGGAACTGTCGAAGGCAAGATTCTGTGCCTTGTTGGCCCACCCGGTGTTGGAAAGACCAGTATCGGCAAG
TCCATAGCTCGCGCTCTGAACAGACAATACTACCGATTCTCCGTTGGTGGTTTGACCGACGTGGCAGAGATCAAG
GGCCACCGACGGACTTACGTTGGTGCTCTGCCTGGCCGCATTATCCAAGCTCTCAAGAAGTGTCAAACCGAAAAC
CCTTTAATCTTGATCGACGAGGTTGACAAGATTGGGCGTGGTCACCAGGGCGATCCGTCCTCTGCTTTGCTTGAA
CTTCTTGACCCCGAACAAAATAACTCGTTCTTAGACCACTACATGGATGTTCCTGTGGATCTTTCCAAGGTCCTC
TTCGTCTGTACAGCCAACGTGACTGACACTATCCCTCGGCCATTGTTGGATCGTATGGAACTAATCGAATTGTCC
GGCTACGTGGCAGACGAGAAGATGGCAATTGCTGAGAAATACCTCGCCCCCGCCGCTCGGGAGCTGACTGGTCTG
AAGGATGTGGATGTGAACCTTGAACGGGATGCCATCGAGGAGCTGATCAAGTCGTATTGCCGTGAGAGCGGTGTC
CGTAACCTGAAGAAGCAAATCGAAAAAGTCTATCGGAAGGCAGCTTTCAAGATTGTCCAAGACCTAGGCGAGGAT
GTGCTGCCCGAAGAGGCGGCACTTACTGAAGCGGGCAAGGCTGCTCAGGAGGAGTCAAAGGAACATGAGCCAGCC
GATCCTGCGCAAGTTCCGGTCGAGCCGGAGAAGTCGACCACAGAGATCCCTCGACTGGCTCTCAAGGTTCCCGAC
ACTGTGCATCTCAGCATCGGCAAGGGAACCTTGAAGGATTACGTTGGACCTCCTGTTTTCACATCCGACCGCCTG
TACGACCAGTTCCCTCCTGGTGTCACCATGGGTCTTGCATGGACCAGCATGGGTGGAGCGGCTCTGTACGTTGAA
TGTATCCTGGAGAACGCATTGAATCACAACTCGCGCCCCGGGCTCGAAATCACCGGCAACCTGCAAAACGTGATG
AAGGAGTCCACCCACATTGCGTATTCATTCGCTAAGTCTGTAATGGCGCGACAATTCCCCGAGAACCGGTTCTTC
GAAAAAGCCAAGGTCCACTTGCACTGCCCCGAAGGCGCTGTCCCAAAGGATGGACCCTCTGCCGGTATCACCATG
GCTAGCGCCTTGTTGTCTTTGGCTTTGAACCACTCCCTTGAGCCAACCGTTGCCATGACCGGAGAGTTGACTGTA
ACTGGTAAGGTTCTGCGCATTGGAGGCTTGAGAGAGAAGACTGTGGCTGCCCGTCGGGCTGGTGCCACAAAAGTC
CTCTTCCCCGCGGACAACACATCTGACTGGCTTGAGCTACCTGAGAACATCAAGGAGGGCATTGAAGGCCACCCG
GTGAACTGGTACTCCGAAGTGTTTGACCTTCTCTTCCCCACTCTCGACCAGGAGGCTGCCCGTACTGTCTGGCAA
AAAGCATTGGCCAAGCCTAAGAAGGAGAGCCACGAGGTCGAGGAAGAGTAG
Gene >Pro_DTO377G3_2|g8108.t1
ATGCTCCGCGGCCAGACCCTCCCCTGGAGAGCTGTACTCCATCAAACGCCACGACCTCTCCTCCGACGGCCGTTT
CTTGCATCACCGAGATATAATGCAACATTCCGATCAACACTAATTTCGGCCCGCTTCGGTGCCTCTCTTCCGTCG
TCTTCCCGCGCCTTCTCTGCAAGCTCCATTCGGCGTAGAGAGAAACCCCCGCCAGAGGACCCTAAAGAGGAATCG
GAAGAAAAGGAAGAGGACGAAACCAGTCACGATGATAAGGGAACGGAACGGGCACCTGAACCGCGGAAGAAGGGA
GCCGATTCAGGGAAGCATGTCCCTTCCGCAGATCAGGTAGCTCCCGCGCGGAGAAAAGACCGGTCATCCGATAAA
GAGCGCGGAGTGGAAGAGGAAGTCAAGAAAGAAGCCAATGCATCAGATAGCAAGGGGAACTCGAATGACACACCT
TCGCCCATCCCACCAAGTGATGGTCCGGCCGACTCCAAGCCTAGCGGCGCAAGCAGCGGCGGTCATGGCGGCAAC
GATGATAGCGGGAAGAAGGGCAAGAAGGCCTCCGGGGAAAAGGCTTTACAAAAGCCGGCAGTTCCCGACGTTTAC
CCACAGGTGATGGCAATTCCCATCGCGAAACGCCCGTTGTTCCCCGGTTTTTACAAAGCGATCACTATTCGCGAC
CCAAATGTCGCCGCTGCGATCCAGGATATGATGAAACGGGGTCAGCCGTATGTCGGAGCGTTCTTGTTCAAGGAT
GACAACGCGGATGGTGACGTGATTGAGAAATTGGACGACGTTTATGACACCGGAGTTTTCGCTCAAATCACCGCC
GCATATCCTCTTCGTGGAGAGTCAAGCGGTGTGACAGCGGTTCTTTATCCCCACCGGCGTATCAAGATCTCGTCG
CTACTTCCCCCCGGAGAGCATACCAAGGCCGCTACACCTCCACCCGCACCTACGTCAGAAGACAAGACGACCGAA
AAGCGAGGTGATGTCGTGGCCAGCTTCGAAGAAGGCGCACCCGAGCCAACTCCCAAAGACCATTACGAACCTACA
TCCTTCCTGAAAAAATACCCTGTCAGCCTTGTCAACGTGGAAAACTTGACCGAAGAGCCGTTCGACAAGAAAAAT
CCAATTATCCGCGCGGTAACCAGTGAAATTGTCAATGTGTGCAAAGAGATCGCCACCTTGAATCCTTTATTCCGC
GACCAAATCTCGGCATTCTACACCGATCAATTTCCAGGAAATCTCAGCGACGAACCGGCGAAATTGGCTGATTTC
GCTGCCGCTGTATCTGCCGGTGAGCTCCACGAGATGCAAGAAGTTCTTGAGACAATGAATATCGAGGAGCGTCTC
CCCAAGGCACTTGTTGTTCTAAAGAAAGAATTGATGAACGCTCAACTGCAATCCAAGATTACCAAAGATGTCGAG
GCCAAGATCCAGAAGCGCCAGCGCGAGTACTGGCTGATGGAGCAAATGAAGGGCATCAAGAGAGAACTTGGTATC
GAGTCCGACGGGAAAGACAAGCTTGTCGAGAAGTTCAAGGAGAAGGCCGAAAAGCTTGCCATGCCCGAGGTCGTC
AAGAAGGTCTTCGACGAGGAGATCAACAAGCTGGCACACCTCGAGCCCGCTGCATCCGAGTTCAACGTCACTCGT
AACTACCTAGACTGGCTAACTCAAATCCCCTGGGGCCAGAAGAGCGTGGAAAATTTTGGCGTCAAGAACGCAGTC
AGTGTTCTCGATGAGGATCATTACGGGTTGAAGGATGTCAAGGATCGTATTCTTGAGTTCATCGCTGTCGGCAAG
CTTCGTGGAACTGTCGAAGGCAAGATTCTGTGCCTTGTTGGCCCACCCGGTGTTGGAAAGACCAGTATCGGCAAG
TCCATAGCTCGCGCTCTGAACAGACAATACTACCGATTCTCCGTTGGTGGTTTGACCGACGTGGCAGAGATCAAG
GGCCACCGACGGACTTACGTTGGTGCTCTGCCTGGCCGCATTATCCAAGCTCTCAAGAAGTGTCAAACCGAAAAC
CCTTTAATCTTGATCGACGAGGTTGACAAGATTGGGCGTGGTCACCAGGGCGATCCGTCCTCTGCTTTGCTTGAA
CTTCTTGACCCCGAACAAAATAACTCGTTCTTAGACCACTACATGGATGTTCCTGTGGATCTTTCCAAGGTCCTC
TTCGTCTGTACAGCCAACGTGACTGACACTATCCCTCGGCCATTGTTGGATCGTATGGAACTAATCGAATTGTCC
GGCTACGTGGCAGACGAGAAGATGGCAATTGCTGAGAAATACCTCGCCCCCGCCGCTCGGGAGCTGACTGGTCTG
AAGGATGTGGATGTGAACCTTGAACGGGATGCCATCGAGGAGCTGATCAAGTCGTATTGCCGTGAGAGCGGTGTC
CGTAACCTGAAGAAGCAAATCGAAAAAGTCTATCGGAAGGCAGCTTTCAAGATTGTCCAAGACCTAGGCGAGGAT
GTGCTGCCCGAAGAGGCGGCACTTACTGAAGCGGGCAAGGCTGCTCAGGAGGAGTCAAAGGAACATGAGCCAGCC
GATCCTGCGCAAGTTCCGGTCGAGCCGGAGAAGTCGACCACAGAGATCCCTCGACTGGCTCTCAAGGTTCCCGAC
ACTGTGCATCTCAGCATCGGCAAGGGAACCTTGAAGGATTACGTTGGACCTCCTGTTTTCACATCCGACCGCCTG
TACGACCAGTTCCCTCCTGGTGTCACCATGGGTCTTGCATGGACCAGCATGGGTGGAGCGGCTCTGTACGTTGAA
TGTATCCTGGAGAACGCATTGAATCACAACTCGCGCCCCGGGCTCGAAATCACCGGCAACCTGCAAAACGTGATG
AAGGAGTCCACCCACATTGCGTATTCATTCGCTAAGTCTGTAATGGCGCGACAATTCCCCGAGAACCGGTTCTTC
GAAAAAGCCAAGGTCCACTTGCACTGCCCCGAAGGCGCTGTCCCAAAGGATGGTATGTGAAACTTATGTTGGTTA
ATATTGTAATAAGTCGGCGGCTAACCATTCCAATAGGACCCTCTGCCGGTATCACCATGGCTAGCGCCTTGTTGT
CTTTGGCTTTGAACCACTCCCTTGAGCCAACCGTTGCCATGACCGGAGAGTTGACTGTAACTGGTAAGGTTCTGC
GCATTGGAGGCTTGAGAGAGAAGACTGTGGCTGCCCGTCGGGCTGGTGCCACAAAAGTCCTCTTCCCCGCGGACA
ACACATCTGACTGGCTTGAGCTACCTGAGGTGAGTCATCAAAATCATTCCATTCTTAGTGGTTACTTTAGCTGAC
TGTTTACTCTAGAACATCAAGGAGGGCATTGAAGGCCACCCGGTGAACTGGTACTCCGAAGTGTTTGACCTTCTC
TTCCCCACTCTCGACCAGGAGGCTGCCCGTACTGTCTGGCAAAAAGCATTGGCCAAGCCTAAGAAGGAGAGCCAC
GAGGTCGAGGAAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail