Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8104.t1
Gene name
Locationscaffold_29:101871..102579
Strand-
Gene length (bp)708
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01230 HIT HIT domain 6.3E-25 21 111

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 61.90 30.63 93.17
5d_25C Five days - 25 degrees Celsius 54.25 25.91 82.59
7d_25C Seven days - 25 degrees Celsius 41.27 18.22 64.32
10d_25C Ten days - 25 degrees Celsius 36.78 15.73 57.84
7d_15C Seven days - 15 degrees Celsius 52.52 24.79 80.25
7d_30C Seven days - 30 degrees Celsius 46.53 21.25 71.80

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.721684 no
3d_25C 7d_25C 0.185175 no
3d_25C 7d_15C 0.645325 no
3d_25C 7d_30C 0.378709 no
3d_25C 10d_25C 0.074740 no
5d_25C 7d_25C 0.418549 no
5d_25C 7d_15C 0.943310 no
5d_25C 7d_30C 0.682957 no
5d_25C 10d_25C 0.219229 no
7d_25C 7d_15C 0.486522 no
7d_25C 7d_30C 0.769831 no
7d_25C 10d_25C 0.786945 no
7d_15C 7d_30C 0.755471 no
7d_15C 10d_25C 0.264459 no
7d_30C 10d_25C 0.511488 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8104.t1
MPALKATTAPIYFGSFIVTPQVFYTTSLTFALVNLKPILPGHVLVSPRRVVPRVTDLTPDETSDLFLTVRRVGRM
VERVYGATSLNIAIQDGADAGQSVPHVHAHIIPRKSADLDHAGGMDAIYDLLDGQEGDLGNAFKNAAPTEEGDQS
ANSGRRSRLPVVDNESRKPRSEDEMKAEADILAREMENEPLD*
Coding >Pro_DTO377G3_2|g8104.t1
ATGCCAGCTCTCAAAGCTACCACAGCGCCAATCTACTTTGGCTCCTTCATTGTCACACCACAGGTCTTCTACACA
ACGTCCCTAACCTTCGCCCTGGTAAACCTGAAACCAATCCTCCCAGGCCACGTCCTAGTCTCACCACGCCGCGTC
GTCCCCCGCGTCACAGATCTCACCCCAGACGAAACAAGCGACCTCTTCCTAACAGTCCGACGCGTGGGTCGGATG
GTCGAGCGCGTATACGGTGCCACAAGCTTGAACATCGCCATTCAGGACGGCGCAGACGCCGGCCAGAGCGTGCCG
CATGTCCATGCGCATATAATCCCGCGCAAGTCGGCGGATTTAGATCATGCCGGTGGCATGGATGCGATTTATGAC
TTGCTAGATGGGCAGGAGGGGGATTTGGGGAACGCGTTTAAGAATGCTGCTCCTACGGAAGAGGGTGACCAGTCT
GCGAATTCGGGGAGGAGATCTAGGCTCCCGGTTGTGGATAATGAGTCGCGCAAGCCTCGCAGTGAAGATGAAATG
AAGGCTGAGGCTGATATTTTGGCGAGGGAAATGGAGAATGAGCCTCTTGATTAA
Transcript >Pro_DTO377G3_2|g8104.t1
ATGCCAGCTCTCAAAGCTACCACAGCGCCAATCTACTTTGGCTCCTTCATTGTCACACCACAGGTCTTCTACACA
ACGTCCCTAACCTTCGCCCTGGTAAACCTGAAACCAATCCTCCCAGGCCACGTCCTAGTCTCACCACGCCGCGTC
GTCCCCCGCGTCACAGATCTCACCCCAGACGAAACAAGCGACCTCTTCCTAACAGTCCGACGCGTGGGTCGGATG
GTCGAGCGCGTATACGGTGCCACAAGCTTGAACATCGCCATTCAGGACGGCGCAGACGCCGGCCAGAGCGTGCCG
CATGTCCATGCGCATATAATCCCGCGCAAGTCGGCGGATTTAGATCATGCCGGTGGCATGGATGCGATTTATGAC
TTGCTAGATGGGCAGGAGGGGGATTTGGGGAACGCGTTTAAGAATGCTGCTCCTACGGAAGAGGGTGACCAGTCT
GCGAATTCGGGGAGGAGATCTAGGCTCCCGGTTGTGGATAATGAGTCGCGCAAGCCTCGCAGTGAAGATGAAATG
AAGGCTGAGGCTGATATTTTGGCGAGGGAAATGGAGAATGAGCCTCTTGATTAA
Gene >Pro_DTO377G3_2|g8104.t1
ATGCCAGCTCTCAAAGCTACCACAGCGCCAATCTACTTTGGCTCCTTCATTGTCACACCACAGGTAAATTGCTCA
TGATCCACTCAACCCCCAGTCTTCTCAACCAACACCAACCACGTTATATCACAGAACTAGCCATAGACACAAGTA
CAACCATAACCATGAACACAACTAACGCCAACACACCAACAGGTCTTCTACACAACGTCCCTAACCTTCGCCCTG
GTAAACCTGAAACCAATCCTCCCAGGCCACGTCCTAGTCTCACCACGCCGCGTCGTCCCCCGCGTCACAGATCTC
ACCCCAGACGAAACAAGCGACCTCTTCCTAACAGTCCGACGCGTGGGTCGGATGGTCGAGCGCGTATACGGTGCC
ACAAGCTTGAACATCGCCATTCAGGACGGCGCAGACGCCGGCCAGAGCGTGCCGCATGTCCATGCGCATATAATC
CCGCGCAAGTCGGCGGATTTAGATCATGCCGGTGGCATGGATGCGATTTATGACTTGCTAGATGGGCAGGAGGGG
GATTTGGGGAACGCGTTTAAGAATGCTGCTCCTACGGAAGAGGGTGACCAGTCTGCGAATTCGGGGAGGAGATCT
AGGCTCCCGGTTGTGGATAATGAGTCGCGCAAGCCTCGCAGTGAAGATGAAATGAAGGCTGAGGCTGATATTTTG
GCGAGGGAAATGGAGAATGAGCCTCTTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail