Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8093.t1
Gene name
Locationscaffold_29:73087..74458
Strand+
Gene length (bp)1371
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00775 Dioxygenase_C Dioxygenase 8.9E-07 131 233

GO

GO Term Description Terminal node
GO:0006725 cellular aromatic compound metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0008199 ferric iron binding Yes
GO:0046914 transition metal ion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0005506 iron ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8093.t1
MVHLASIVAVGLTALTGIVSAHPGHDVKAEAAERAAFLKEASVHSRSLAQCTSHLQRRGHQSRNVARRHTSVKNI
RRRLGLQHTNHFLKARSDDALDTSHHSNLTSVDYSTDPEVLFGAEATCILGPEVTQGPYYVTGELVRKNIAESQE
GIPLYLDIQLINTNTCEPIPQLYTDLWHCNSTGVYSGVVASGNGNSNDSTNLDTTFNRGIQKSNRDGVVQFQTTF
PGHYTGRATHIHVLAHPANETRVLANGTISGLYTTHSSHVGQIFFDQDLITAADEVAPYSTNTQEVTTNADDSIL
GEELDVIDPFMEYIYLGDDISEGIFAWITVGLDPTQDTTVTPAAYYTEDGGVENENAGAGGGSGAPPDDGASSGS
SSTTAA*
Coding >Pro_DTO377G3_2|g8093.t1
ATGGTTCATCTCGCTTCCATTGTTGCCGTCGGCCTGACTGCTCTGACCGGCATTGTCTCCGCTCACCCGGGACAT
GATGTCAAAGCCGAAGCCGCCGAGCGAGCTGCGTTCTTGAAAGAGGCCTCTGTTCACTCGCGCAGTCTTGCGCAG
TGTACCTCTCATCTCCAGCGTCGAGGCCACCAAAGCCGAAACGTGGCCCGTCGTCACACATCCGTGAAGAACATA
CGTCGCCGCCTTGGTCTTCAGCATACCAACCACTTCCTCAAGGCGCGCTCCGATGACGCCCTGGATACCTCGCAT
CACTCCAATCTCACGAGTGTGGATTATTCGACCGATCCCGAAGTGTTGTTTGGCGCCGAGGCGACATGCATTCTC
GGACCGGAGGTGACACAGGGACCCTACTATGTCACCGGTGAGCTCGTTCGTAAGAACATCGCCGAGTCCCAGGAA
GGTATTCCTCTCTACCTGGACATCCAGCTGATCAACACCAACACCTGCGAACCCATTCCGCAGCTCTACACGGAC
TTGTGGCACTGCAACTCCACTGGTGTCTATTCTGGAGTCGTCGCCAGCGGAAACGGAAACTCCAACGATTCCACC
AACCTCGACACGACCTTCAACCGAGGTATCCAGAAGAGTAACAGGGACGGTGTCGTTCAGTTCCAAACAACCTTC
CCAGGTCATTACACTGGCCGGGCAACTCACATCCACGTTCTCGCCCACCCAGCCAACGAAACCAGAGTCCTCGCC
AACGGCACCATCTCCGGCCTCTACACCACGCATTCATCGCACGTCGGACAGATCTTTTTCGACCAGGATCTCATC
ACCGCCGCCGACGAAGTCGCCCCTTACTCAACCAACACACAGGAAGTGACCACCAACGCCGACGACAGCATTCTC
GGCGAAGAGCTCGACGTCATTGACCCCTTCATGGAATACATCTATCTGGGCGACGATATCTCCGAGGGAATCTTC
GCTTGGATCACTGTTGGTTTGGACCCTACACAGGATACCACTGTTACCCCTGCGGCTTATTATACTGAGGACGGT
GGTGTTGAGAATGAGAATGCTGGTGCCGGTGGTGGTAGTGGGGCCCCTCCCGACGACGGTGCTTCCTCTGGCAGT
TCCTCGACTACGGCTGCTTAA
Transcript >Pro_DTO377G3_2|g8093.t1
ATGGTTCATCTCGCTTCCATTGTTGCCGTCGGCCTGACTGCTCTGACCGGCATTGTCTCCGCTCACCCGGGACAT
GATGTCAAAGCCGAAGCCGCCGAGCGAGCTGCGTTCTTGAAAGAGGCCTCTGTTCACTCGCGCAGTCTTGCGCAG
TGTACCTCTCATCTCCAGCGTCGAGGCCACCAAAGCCGAAACGTGGCCCGTCGTCACACATCCGTGAAGAACATA
CGTCGCCGCCTTGGTCTTCAGCATACCAACCACTTCCTCAAGGCGCGCTCCGATGACGCCCTGGATACCTCGCAT
CACTCCAATCTCACGAGTGTGGATTATTCGACCGATCCCGAAGTGTTGTTTGGCGCCGAGGCGACATGCATTCTC
GGACCGGAGGTGACACAGGGACCCTACTATGTCACCGGTGAGCTCGTTCGTAAGAACATCGCCGAGTCCCAGGAA
GGTATTCCTCTCTACCTGGACATCCAGCTGATCAACACCAACACCTGCGAACCCATTCCGCAGCTCTACACGGAC
TTGTGGCACTGCAACTCCACTGGTGTCTATTCTGGAGTCGTCGCCAGCGGAAACGGAAACTCCAACGATTCCACC
AACCTCGACACGACCTTCAACCGAGGTATCCAGAAGAGTAACAGGGACGGTGTCGTTCAGTTCCAAACAACCTTC
CCAGGTCATTACACTGGCCGGGCAACTCACATCCACGTTCTCGCCCACCCAGCCAACGAAACCAGAGTCCTCGCC
AACGGCACCATCTCCGGCCTCTACACCACGCATTCATCGCACGTCGGACAGATCTTTTTCGACCAGGATCTCATC
ACCGCCGCCGACGAAGTCGCCCCTTACTCAACCAACACACAGGAAGTGACCACCAACGCCGACGACAGCATTCTC
GGCGAAGAGCTCGACGTCATTGACCCCTTCATGGAATACATCTATCTGGGCGACGATATCTCCGAGGGAATCTTC
GCTTGGATCACTGTTGGTTTGGACCCTACACAGGATACCACTGTTACCCCTGCGGCTTATTATACTGAGGACGGT
GGTGTTGAGAATGAGAATGCTGGTGCCGGTGGTGGTAGTGGGGCCCCTCCCGACGACGGTGCTTCCTCTGGCAGT
TCCTCGACTACGGCTGCTTAA
Gene >Pro_DTO377G3_2|g8093.t1
ATGGTTCATCTCGCTTCCATTGTTGCCGTCGGCCTGACTGCTCTGACCGGCATTGTCTCCGCTCACCCGGGACAT
GATGTCAAAGCCGAAGCCGCCGAGCGAGCTGCGTTCTTGAAAGAGGCCTCTGTTCACTCGCGCAGTCTTGCGCAG
TGTACCTCTCATCTCCAGCGTCGAGGCCACCAAAGCCGAAACGTGGCCCGTCGTCACACATCCGTGAAGAACATA
CGTCGCCGCCTTGGTCTTCAGCATAGTATGTTTTGTGTTTTGAAGTCTTCAACATACTACCACGTTCTAACGACC
CATAGCCAACCACTTCCTCAAGGCGCGCTCCGATGACGCCCTGGATACCTCGCATCACTCCAATCTCACGAGTGT
GGATTATTCGACCGATCCCGAAGTGTTGTTTGGCGCCGAGGCGACATGCATTCTCGGACCGGAGGTGACACAGGG
ACCCTACTGTTAGCTTCCCATCTTTCTTGTGATTGAATCTTACTCACGCTGTTTCGGTTTAGATGTCACCGGTGA
GCTCGTTCGTAAGAACATCGCCGAGTCCCAGGAAGGTATTCCTCTCTACCTGGACATCCAGCTGATCAACACCAA
CACCTGCGAACCCATTCCGCAGCTCTACACGGACTTGTGGCACTGCAACTCCACTGTAAGTATACTGCATCCCCG
ATATCACATACAATACGAACCTTTCACTTACACGATCATCATAGGGTGTCTATTCTGGAGTCGTCGCCAGCGGAA
ACGGAAACTCCAACGATTCCACCAACCTCGACACGACCTTCAACCGAGGTATCCAGAAGAGTAACAGGGACGGTG
TCGTTCAGTTCCAAACAACCTTCCCAGGTCATTACACTGGCCGGGCAACTCACATCCACGGTATACACAATTCCC
CTTAGTTAAGCCAATTCCAATACTAACAAACACATAGTTCTCGCCCACCCAGCCAACGAAACCAGAGTCCTCGCC
AACGGCACCATCTCCGGCCTCTACACCACGCATTCATCGCACGTCGGACAGATCTTTTTCGACCAGGATCTCATC
ACCGCCGCCGACGAAGTCGCCCCTTACTCAACCAACACACAGGAAGTGACCACCAACGCCGACGACAGCATTCTC
GGCGAAGAGCTCGACGTCATTGACCCCTTCATGGAATACATCTATCTGGGCGACGATATCTCCGAGGGAATCTTC
GCTTGGATCACTGTTGGTTTGGACCCTACACAGGATACCACTGTTACCCCTGCGGCTTATTATACTGAGGACGGT
GGTGTTGAGAATGAGAATGCTGGTGCCGGTGGTGGTAGTGGGGCCCCTCCCGACGACGGTGCTTCCTCTGGCAGT
TCCTCGACTACGGCTGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail