Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8063.t1
Gene name
Locationscaffold_28:254204..266502
Strand+
Gene length (bp)12298
Transcript length (bp)11967
Coding sequence length (bp)11967
Protein length (aa) 3989

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 8.9E-75 10 260
PF00501 AMP-binding AMP-binding enzyme 1.2E-74 3029 3439
PF00668 Condensation Condensation domain 9.3E-66 2568 3002
PF14765 PS-DH Polyketide synthase dehydratase 7.5E-54 951 1247
PF08659 KR KR domain 6.3E-51 2115 2288
PF00698 Acyl_transf_1 Acyl transferase domain 3.3E-46 557 884
PF07993 NAD_binding_4 Male sterility protein 4.0E-33 3674 3895
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 7.0E-30 270 394
PF00550 PP-binding Phosphopantetheine attachment site 7.9E-06 2411 2465
PF00550 PP-binding Phosphopantetheine attachment site 9.8E-10 3561 3629
PF08242 Methyltransf_12 Methyltransferase domain 2.5E-13 1427 1528
PF00106 adh_short short chain dehydrogenase 2.9E-12 2118 2288
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.0E-11 3672 3860
PF13649 Methyltransf_25 Methyltransferase domain 1.5E-11 1426 1526
PF13847 Methyltransf_31 Methyltransferase domain 1.4E-11 1423 1533
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 9.0E-11 413 517
PF13489 Methyltransf_23 Methyltransferase domain 2.1E-10 1418 1580
PF08241 Methyltransf_11 Methyltransferase domain 6.8E-10 1427 1530
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 2.3E-08 3673 3837
PF05401 NodS Nodulation protein S (NodS) 5.1E-05 1424 1546
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 9.2E-05 1419 1537

GO

GO Term Description Terminal node
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0003824 catalytic activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0009877 nodulation Yes
GO:0008168 methyltransferase activity Yes
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0050662 coenzyme binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0009312 oligosaccharide biosynthetic process Yes
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016051 carbohydrate biosynthetic process No
GO:0016229 steroid dehydrogenase activity No
GO:0016740 transferase activity No
GO:0044403 symbiont process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0044419 interspecies interaction between organisms No
GO:0044238 primary metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0048037 cofactor binding No
GO:0005488 binding No
GO:0051704 multi-organism process No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8063.t1
MTGGLQHTGEPIAIVGSACRFPGDATTPSKLWDLLRSPRDVLSEIPESRFSTKAFYHPDGLHHGTTNVRHSYLLS
DDHRLFDAQFFGTKPVEANSIDPQQRLLLETVYEGLETSGIPMEKLQGSNTGVYVGLMTNDYADMLGRDVQNFPT
YFASGTARSILSNRVSYFFDWRGPSMTIDTACSSSLIALHQAVQSLRSGETDVAVAAGTNLLLGPEQYIAESKLK
MLSPTGRSRMWDKDADGYARGDGIAAIILKPLSAALANGDHIECIVRETGANQDGRTKGITMPNPMAQADLIRTT
YARAGLDLSNPTDRPQYFEAHGTGTPAGDPVEAEAISTAFFGQAAKYQRDSNREHPLYVGSIKTVIGHTEGTAGL
AAVLKASLALQHAVIPPNLLLNELSSTVLPFYNDLEILQVAKEWPQLSENTPRRASVNSFGFGGANAHAILEEFD
TRPLACGQNAADDSSGAVLPFNFSASSEKSLLTNIAAYSAYLRNNSDVNIRDLSWTLNCRRSTLPVRLSVSASSL
GELAAGLDEAVLSLAITPSTQTGSILEPKLLWVFTGQGAQWARMGAELLESSPMVSDCIARLDRSLRDLPTEHRP
VWSLRGELVKDKFSSRIGEAAFSQPLCTAIQIALVQLLRAANVKPTAVVGHSSGEIAAAYAAGYLNEEDAIRIAY
YRGWSLQYTTSQGGQIGAMMAAGTSFEDAKELCEMPSLENRICVAASNSSASVTLSGDADAIDEAREILEDEKKF
ARLLKVDKAYHSHHMLSCAAPYIAAIRTCGITVQRPPSGSATWISSVYGENIDSVDENLADTYWSNNMVKPVLFS
QAVTYAVGAAGPFDMALEIGPHPALKGPSMQTIQEVSGQTLPYTGTLNRGKKDSEAFSSALGALWIALGEGVVDF
AGFEMKAMQNQNTRSPELIKGLPSYSWDHDRVYWHESRSSTAIRTEKEPFHPLLGVKCPDGTDNELRWRNYLHPR
EVPWLAHHQVQGQMVFPAAGYISAAVECIIQKYGLGSVQLIDFHDVVIGQALVLEENGGVETIFRLSIDQVQADC
VSASFACHSDANKGSSNMSLHASAAIQIILGDPKHDILPPHAHPQGSFLDLEADRFYNSVSELGFGYTGPFQALF
NLRRKMDEASGLIAVPVDSKTERPLIIHPASLDGAIQSIMLAYSFPGDGRLRTLYLPTRIDRLRLNPTACVALGA
CGTDLPFYSAVTDARFAELSGDVDIFSADGRHTLVQLEGLHTTPLSPLTSSNDVPFFTEVVWDVDRPTLRQLKKA
EGMLPQEGSLGVDLERVAHFYLKKLENSLQDFDHANATWDHTRFLSYVEHCTTSVANGKHKFAKAEWANDTMDDV
APILNRHSDCIDIKALCSVGENLPAVIRGDQNLLEILMRDNMLAEFYAKTLGIDAYLETIAQTARQIGHRYPHVN
VLEIGAGAGATSERVLRAMGSSFTSYTYTDILDSQFDNARERFSDYQSRMAFKLLDIEKDIGEQDYEEGCFDLVI
APLALYATRNLESTLTNVRRLLKPGGYLVMLELTDSDVMRFGLIFGGLPGWWLGYKEGRTLSPCISEEKWEGLMQ
KTGFSGFEALLSSSRTSPLPFSVMITQAVDHRVNFLRDPLAANHTPLGVNSLTIIGGKTSLTADIVADMKTAVRP
HYSNIYTAGSLDDLVSANLPVMGSVISLIELDGPVLRHMSPNNLRSFQELFKQSKNVLWVGHGAQGENPYGNMFT
GVQRTLAMEMTHLHIHFLNLRSLYDADSNIIATKLLHLEAAEIWDQSGQLDGMLWSNERELLLENGNFKVPRFRL
NSGRNDRYNSSRRLIIKEVERKKSVVTIRPTEIGYQIEEKDPQDSPSFPDDVHIDVAHSFLRAVRITPTDNYFLL
VGKNKWNGERVVALSHTLDSQVRVPHGLTVRCGDSEELGIRSILTLYSHFLALSMLQQLQPGTILAVLDPGFSLA
PVLTKYAAEKGVQLVLLTTKEGHCSWPWIRIHPNSTRREVLSKLPGNISRLVNMSGSSDVTTLLRTCLRTDCHFE
SESTLTANISQSQYTSDTGQLAMQLQNTWARAQYDLMPVNMHKFVPLGLEDLIRAQSPLAGQSLIAWGQSQLAVQ
VRPATKAVKFSKDKTYWLVGLTGGLGLSLCQWMIGQGARYIALSSRNPKIDDQWLQRMAANGCTVRVFSNDITNR
ESVQATHRNISETMPPIAGVAQGAMVLQDTMFIDLDLPRLEKVLRPKVEGSILLDELFPEDTLEFMVFFSSMAAM
TGNPGQVAYNAANMFMASLAAQRRNRGLAAHAINIGAIVGNGYVTRELNMGQQSYLYRVGHSWMSEQDFHEVFAE
GVLSCRERVGSAELCCGLRIDDDESKSWVSNPIFQHLVYKSSKLVVTDKKGKSGVLIKTRLFEATSNQEVIEILQ
DSFVLKLQSALQADPNKPMLDMSPDELGVDSLVAVDLRSWFLKELGVDMPVLKIFNAASIRELLATAAEVLPESL
IPNVMAEQAVKSQAHQPNPSTPSPTLPVDKIVPDTRARSMESNFALPDATNAYSGSSATSLFTGDSNSEDNDDTS
SSVFTDSSKVGPPKREIQRTLPMSYGQSRFWFLEHLVEDKTAFNITPTFELSGRLRIQEFANAVKATGQHHEALR
TFFFTDNERNHIQGVWTKSSLQLEHVAISDKAEVEEAEKQMKAHVFNLSDGEVMRVQLLSLDLEKHWIIFGFHHI
NMDGISFEVFWSDVEKAYQGQPLSEDGLQYPDFTMRQLREYEEGTWAGDIAYWRAQYTEIPPTIPLLPFALQPMR
PKVAQFRSHTAHIRLDVSLSDSIDRCCRMFKSTPFHFHLAVWKTLLLRFFDVKEVCIGLGDGNRTDADILRSVGL
FLNLLPVRFSQQPGQSFGESLKEVRNITQGAFSHSRVPFDVILTELNVPRSASHNPLCQTLFNYRPKVEQSRSFC
GCVADGALLGGGETSFDLGLDVGNVGAGETLIHLSAQTSLYGMEHAEILVSSYVNILRSFLQNPATRVTWPKLHS
KDDIQEAVIAGRGPELRDEWPVTIVHRLDEVASRYPDRVALRNHDGNSLTYSEVQRRIDVIANELLRNEVGSGTR
VGILQSPSADWICSLMAILRVGGVYIPLDTKVGMNRLAMIMKETQAPMVLVDTKSMPDYTLLHTTAKPIDVCSLN
ASTARPIRNMAVPSQTAVIMYTSGSTGVPKGIMIAHSAYVHHVQSSSVVWELKQGNETILHQSSYAWDASLWQIM
VSLCSAATLVIASDLTRGDPIALTRLIASENVTCTLATPTEYLAWLRYGRSHLSNSRLSTAVCGGEFMPSGLIKE
IKNLHRPDLKLINAYGPAEISVACSASEVPYDLLGSTSTSPAQALYTLPNYSVYIVDQTLNPVPIGIPGEVVVGG
AGVAQGYLDGTKTAERFSSDRYASKFFQEKDWTTIHRTGDRGKLNRDGGLILLGRMDGDNQIKLRGIRINIEEIE
TAIVSSSAGAITQAVVSVRLDANQSEGDQFLVAFVIMAATHESENILQFLARLLQELPLPPHMKPAAIIPVESIP
QNTSGKTDRVAVSALSIPFISSQLPDNSTLTAFEQSLRQLWRQALPRELSSFHSIDSESDFFHVGGSSLALVNLQ
VLIQEKFGTSMALYQLFEASSLRGMAARIQDISRPALEPDVNWDAEIEVATDLTPPLNYESTHIIASGVKTVVLT
GATGFLGKEILRGLIHDENVLSVHCLAVRKRSSGLSELFSHPKVHLHYGDLGAPQLGLSESEIKSIFSCADIVIH
NGADVSFMKTYQTLKLINVASTKEIVKLALPRRIPLHFVSSAGVARLTGQESFGEMSVSSYPPPSRPTDGYIAAK
WVSEIYLEHVNRRFGLPVWIHRPSSITGTDAPELDLMGNVMRFTKETQKVPDSSSWSGVFDLVSVQSAARQLLEA
VYQSGIATTEAVTYLYESGETKIGRDEIMPLMESSSGQQFQVVSLDEWVNAAEQAGMSVLLGEYLRRASDGQVLL
PRLIKNSRFSEDE*
Coding >Pro_DTO377G3_2|g8063.t1
ATGACAGGTGGTCTTCAGCACACCGGAGAACCGATTGCCATCGTGGGAAGTGCCTGCCGCTTTCCTGGTGATGCA
ACAACACCCTCGAAACTTTGGGACTTGCTCAGATCACCACGAGATGTCCTTAGCGAGATTCCAGAAAGCCGTTTT
AGCACCAAAGCATTTTACCACCCCGATGGCCTTCACCATGGCACAACGAATGTTCGACATTCCTATTTGTTGTCC
GACGATCATCGACTGTTTGACGCCCAATTTTTTGGAACCAAGCCAGTGGAAGCAAACTCGATTGATCCGCAACAA
AGGCTCTTGCTTGAGACTGTTTACGAGGGACTCGAAACATCTGGCATTCCCATGGAAAAGCTACAAGGGTCCAAC
ACCGGCGTATATGTTGGTTTGATGACCAATGACTATGCGGATATGTTGGGTCGGGATGTGCAGAACTTCCCAACT
TATTTTGCGTCGGGAACTGCTCGAAGCATTCTATCCAATCGAGTGTCCTACTTTTTCGACTGGCGGGGACCTTCC
ATGACCATCGACACGGCATGTTCTTCTAGTCTGATTGCCCTTCACCAGGCCGTACAGAGCCTGCGAAGTGGCGAG
ACTGATGTTGCGGTAGCAGCAGGAACCAACCTTCTGCTTGGACCGGAGCAATATATCGCAGAGAGCAAGCTGAAG
ATGCTCTCCCCGACGGGCCGCTCGCGCATGTGGGATAAAGATGCAGATGGATATGCACGCGGTGACGGAATTGCT
GCCATAATACTCAAACCATTAAGTGCAGCATTGGCGAATGGAGATCACATCGAATGCATCGTTCGAGAGACAGGT
GCCAATCAAGACGGTCGTACCAAAGGAATCACGATGCCCAACCCTATGGCTCAAGCAGACCTTATTCGGACTACG
TATGCCCGAGCTGGACTAGATCTTTCCAACCCCACCGACCGGCCACAATATTTCGAAGCTCACGGTACCGGAACT
CCTGCAGGTGACCCAGTCGAGGCGGAGGCCATCAGTACTGCATTCTTTGGACAAGCAGCCAAGTATCAGCGCGAT
AGTAACCGAGAGCACCCCTTGTATGTTGGGTCAATTAAAACAGTGATCGGGCACACTGAGGGCACGGCTGGATTA
GCAGCGGTCCTCAAGGCATCACTTGCTTTACAACATGCTGTCATCCCACCAAACCTATTGCTCAATGAGTTGAGT
TCCACGGTACTTCCCTTCTACAACGACCTTGAAATCCTTCAAGTTGCGAAAGAATGGCCGCAGCTTTCAGAGAAC
ACCCCTCGTCGTGCTAGTGTCAACAGCTTTGGCTTTGGCGGCGCAAATGCGCATGCAATTTTGGAAGAATTCGAT
ACGCGCCCGCTTGCCTGTGGTCAGAACGCTGCAGATGACAGCTCCGGAGCAGTGTTACCATTCAATTTCTCTGCC
TCCTCCGAAAAGTCGCTTCTCACCAACATTGCAGCATACTCGGCGTATTTGCGAAATAATTCGGATGTCAATATC
CGTGATTTGTCATGGACATTGAACTGCCGACGTTCCACTCTGCCAGTACGTTTGTCGGTGTCTGCATCAAGCCTA
GGAGAGCTTGCTGCAGGGCTGGATGAAGCAGTACTGTCCTTGGCAATAACACCAAGCACGCAAACAGGAAGTATC
CTCGAACCGAAACTCCTTTGGGTGTTTACGGGCCAAGGAGCACAGTGGGCAAGGATGGGTGCTGAACTGCTCGAA
AGCTCGCCAATGGTCAGTGATTGTATCGCCCGACTCGATCGGTCTTTGCGGGATTTACCCACTGAGCATCGCCCT
GTTTGGTCGCTGAGGGGGGAGCTTGTGAAAGATAAGTTTTCATCCCGTATTGGGGAGGCGGCGTTTTCGCAACCT
CTCTGTACCGCGATTCAAATTGCGTTGGTTCAGCTTCTCCGAGCAGCCAATGTGAAACCCACTGCTGTCGTTGGC
CATTCGTCTGGGGAGATTGCCGCAGCGTATGCCGCGGGGTATCTCAACGAAGAGGATGCTATCCGCATTGCCTAT
TACCGCGGATGGTCTCTTCAGTATACAACTTCCCAGGGAGGACAGATAGGGGCAATGATGGCCGCGGGAACATCA
TTTGAGGATGCAAAGGAGCTTTGCGAGATGCCGTCCCTCGAGAACAGAATTTGCGTGGCAGCTAGCAACTCCTCC
GCCAGCGTCACACTTTCCGGGGACGCCGATGCGATCGATGAGGCTAGAGAAATTCTTGAAGATGAGAAAAAATTT
GCTCGCTTGTTGAAAGTGGACAAAGCTTATCACTCACATCACATGCTTTCCTGCGCAGCTCCTTATATCGCAGCG
ATCCGCACGTGCGGCATAACAGTTCAGCGTCCACCGAGTGGCAGTGCTACCTGGATTTCTAGTGTGTATGGGGAA
AACATTGACAGCGTGGATGAGAATCTTGCCGACACGTACTGGAGCAATAACATGGTCAAGCCCGTACTATTCTCC
CAGGCTGTCACTTATGCCGTTGGTGCAGCTGGGCCATTCGACATGGCTTTGGAGATTGGTCCTCACCCAGCACTG
AAAGGACCTTCAATGCAGACGATCCAAGAAGTGTCTGGCCAGACATTGCCTTACACCGGGACCCTAAATCGTGGA
AAAAAGGACAGCGAGGCTTTCTCATCCGCCCTAGGCGCCCTATGGATTGCCTTGGGTGAGGGTGTCGTGGACTTC
GCAGGGTTTGAGATGAAAGCAATGCAAAATCAAAACACTCGATCTCCAGAGCTCATAAAAGGCCTTCCATCGTAT
TCGTGGGACCATGATCGGGTTTATTGGCACGAATCTCGATCATCTACCGCAATACGCACTGAAAAGGAACCATTC
CACCCCCTATTGGGTGTCAAATGCCCCGATGGGACAGACAATGAGTTACGCTGGCGCAACTATCTTCACCCTAGG
GAGGTTCCATGGCTGGCACATCACCAGGTCCAAGGCCAAATGGTATTCCCTGCAGCTGGTTATATATCGGCGGCG
GTTGAGTGTATCATTCAAAAGTATGGCCTGGGTTCTGTGCAACTGATCGACTTCCATGATGTGGTCATCGGACAG
GCATTGGTATTGGAAGAGAACGGGGGAGTGGAAACGATTTTCAGACTTTCCATCGACCAAGTCCAGGCCGATTGC
GTGTCTGCGTCCTTTGCCTGTCATTCTGACGCTAATAAGGGGTCATCCAACATGTCTCTTCACGCATCTGCCGCC
ATACAAATTATTTTGGGTGACCCCAAGCACGATATCCTCCCACCACACGCCCACCCGCAAGGCTCATTCCTGGAT
CTGGAAGCAGACCGATTCTACAATTCAGTTTCAGAGCTTGGGTTTGGCTATACCGGCCCCTTCCAGGCCCTTTTC
AACTTGCGCAGAAAAATGGACGAGGCATCGGGTTTGATTGCTGTCCCGGTGGATTCCAAAACTGAAAGACCGTTG
ATCATTCACCCAGCCTCTCTTGACGGAGCTATTCAGTCCATCATGCTTGCTTATTCCTTTCCAGGTGATGGACGC
TTGCGCACCCTTTACCTTCCCACTCGAATTGACAGGCTTCGCCTCAATCCAACCGCCTGTGTCGCTCTTGGTGCT
TGTGGTACAGATTTGCCCTTTTATTCTGCGGTCACGGATGCCCGCTTTGCTGAACTCTCTGGCGATGTTGATATA
TTTTCAGCAGACGGGAGACATACTTTGGTTCAACTGGAAGGGCTTCATACCACACCCTTGAGTCCATTGACATCA
TCAAATGATGTTCCCTTTTTCACGGAAGTGGTATGGGATGTTGATAGACCCACCTTGCGACAACTTAAGAAAGCT
GAAGGCATGCTTCCCCAAGAGGGTTCCCTAGGCGTGGATCTCGAGCGCGTGGCACATTTCTACTTGAAAAAACTT
GAAAATTCGCTCCAGGACTTCGATCATGCAAATGCAACTTGGGACCATACACGTTTTCTCTCATATGTGGAGCAT
TGTACAACCTCTGTTGCTAATGGAAAACATAAATTCGCAAAGGCGGAATGGGCCAATGACACCATGGACGATGTT
GCTCCAATTCTGAATCGTCATTCCGACTGCATCGACATCAAAGCACTGTGTTCCGTTGGGGAGAACCTTCCTGCT
GTCATTCGCGGAGATCAGAATTTACTTGAAATCCTGATGCGCGACAATATGCTAGCGGAATTTTACGCCAAAACA
CTTGGAATAGACGCATACTTGGAAACCATCGCACAGACGGCTCGTCAGATCGGCCATAGATACCCCCATGTCAAT
GTTTTGGAGATTGGAGCTGGCGCCGGCGCTACTTCGGAACGAGTCCTTCGTGCAATGGGCTCCTCATTTACATCA
TACACATATACCGATATTTTGGACTCACAGTTCGATAACGCGCGTGAAAGATTCTCGGATTACCAATCTAGAATG
GCATTCAAGTTGTTGGACATCGAGAAAGACATCGGGGAACAAGACTATGAAGAGGGTTGTTTTGACCTTGTCATT
GCTCCTCTAGCCCTGTATGCCACCAGAAATCTTGAGTCAACCCTCACAAATGTTCGACGGCTACTAAAGCCTGGT
GGGTACCTGGTTATGCTCGAACTCACCGACTCGGATGTCATGCGCTTCGGGTTGATTTTTGGTGGCCTACCAGGC
TGGTGGTTAGGCTACAAGGAGGGACGAACCTTATCCCCTTGTATATCGGAGGAGAAATGGGAAGGATTGATGCAA
AAAACAGGATTTTCTGGTTTCGAAGCCTTGTTGTCATCTTCCAGAACCTCGCCTCTGCCATTCTCCGTCATGATT
ACCCAAGCTGTCGATCACCGCGTCAATTTTCTTCGTGATCCCCTAGCAGCGAATCATACACCACTAGGTGTGAAC
TCGTTGACAATCATCGGAGGGAAAACATCCTTGACTGCTGATATCGTAGCCGATATGAAGACTGCGGTCCGTCCC
CACTACAGCAATATCTACACAGCTGGCTCTTTAGATGACCTCGTCTCGGCAAATCTTCCCGTAATGGGGTCAGTG
ATTAGTCTGATTGAATTGGATGGGCCTGTTCTCAGGCACATGTCTCCTAATAATCTGAGGTCATTCCAAGAGCTC
TTCAAACAAAGCAAGAATGTTCTGTGGGTGGGACACGGTGCCCAGGGAGAGAATCCCTATGGCAACATGTTCACA
GGAGTTCAACGCACATTGGCCATGGAGATGACTCACCTCCATATCCATTTCCTGAACCTCCGTTCGCTTTATGAC
GCTGATTCCAATATTATCGCTACAAAGCTGCTCCATTTGGAAGCCGCCGAAATTTGGGATCAGAGTGGCCAGCTC
GATGGGATGTTGTGGTCCAACGAGAGGGAGCTGCTGCTAGAGAATGGGAATTTCAAAGTTCCTCGATTCCGCCTG
AACTCTGGTCGGAACGATCGATACAATTCCTCAAGGCGTCTTATTATTAAAGAGGTTGAACGTAAAAAATCCGTG
GTGACCATCCGACCAACTGAAATTGGATATCAAATTGAAGAAAAGGACCCTCAAGACTCGCCCTCTTTCCCGGAT
GATGTGCATATTGATGTGGCTCACTCTTTCCTCCGTGCCGTCCGCATCACTCCAACGGACAATTATTTCTTGCTG
GTTGGGAAGAATAAGTGGAATGGTGAGCGTGTGGTCGCTCTGTCGCATACTCTGGACTCTCAAGTTCGTGTGCCA
CATGGCCTGACGGTGCGATGTGGAGATTCCGAAGAGCTAGGAATTCGATCGATACTCACCCTCTATTCCCATTTC
CTTGCTCTCTCTATGCTCCAACAGCTTCAACCAGGAACAATATTGGCCGTGTTAGACCCTGGCTTCTCGCTAGCA
CCAGTCCTTACGAAATACGCAGCAGAAAAGGGTGTGCAACTTGTCCTTTTGACAACAAAGGAAGGACATTGCTCA
TGGCCATGGATCCGAATCCACCCAAACTCCACCCGGCGTGAAGTATTAAGTAAGCTACCTGGCAATATTTCACGC
CTTGTCAATATGAGTGGCAGCTCTGATGTGACTACTCTCCTGAGGACATGCTTGCGGACAGACTGTCATTTTGAG
AGCGAGAGCACTTTGACTGCAAACATCTCTCAATCTCAGTACACCTCAGATACAGGCCAATTGGCTATGCAGCTG
CAGAATACCTGGGCGAGAGCACAATACGACCTGATGCCAGTTAATATGCACAAGTTTGTTCCTCTAGGACTTGAG
GACCTGATTCGCGCACAATCTCCGCTTGCGGGCCAGTCTTTAATTGCATGGGGTCAATCGCAGCTTGCTGTCCAA
GTTCGCCCTGCTACCAAAGCTGTCAAATTCTCAAAGGACAAAACTTACTGGCTAGTTGGACTAACAGGCGGGCTC
GGTTTGTCGCTTTGCCAGTGGATGATCGGACAGGGGGCACGATACATCGCGCTATCAAGTCGAAACCCAAAGATC
GATGACCAATGGCTGCAGAGAATGGCTGCGAATGGATGCACTGTCCGAGTATTCTCCAATGACATAACGAATCGG
GAATCTGTTCAAGCAACCCATCGTAACATCAGCGAAACCATGCCTCCTATCGCGGGTGTTGCACAAGGTGCGATG
GTGCTCCAGGACACAATGTTCATTGATTTAGATCTCCCTCGCCTTGAGAAGGTTCTCCGTCCTAAAGTTGAAGGT
AGTATATTACTGGACGAATTGTTCCCAGAGGACACGTTGGAATTTATGGTTTTCTTCTCGTCGATGGCTGCGATG
ACGGGAAACCCTGGCCAGGTTGCCTATAATGCCGCGAATATGTTTATGGCGAGTCTGGCAGCCCAACGCCGAAAC
CGTGGATTGGCAGCACATGCGATCAACATCGGCGCGATTGTCGGTAACGGCTACGTTACACGAGAGCTGAACATG
GGCCAGCAATCATACCTTTACCGAGTCGGGCATTCATGGATGTCTGAACAAGACTTCCATGAGGTGTTTGCCGAA
GGTGTACTTTCTTGTAGGGAGCGTGTCGGGAGCGCTGAGTTATGCTGTGGACTCAGAATTGACGATGATGAGTCG
AAGAGTTGGGTTTCTAACCCAATTTTTCAACATCTGGTCTACAAGTCTAGCAAACTTGTGGTGACAGACAAGAAA
GGGAAATCTGGCGTGTTGATAAAAACACGCTTATTCGAGGCAACTTCAAACCAGGAAGTCATCGAGATCTTGCAA
GATAGCTTTGTTTTGAAGCTCCAGTCCGCCCTTCAGGCTGATCCCAACAAGCCTATGTTGGACATGAGTCCGGAT
GAGCTTGGTGTCGATTCATTGGTCGCTGTTGACCTTCGATCGTGGTTCCTCAAGGAGCTGGGGGTGGATATGCCG
GTGCTGAAAATCTTTAACGCGGCGTCAATTCGTGAGCTTTTGGCCACTGCTGCAGAAGTTCTGCCAGAATCTTTG
ATCCCCAATGTGATGGCAGAACAGGCTGTAAAGTCACAGGCGCACCAGCCTAACCCTTCAACACCTTCCCCCACT
TTGCCCGTGGATAAAATAGTTCCAGATACCAGAGCAAGGTCTATGGAGTCAAATTTTGCACTTCCTGATGCAACG
AATGCGTACAGTGGCAGCTCGGCGACGTCGTTATTTACCGGAGACTCGAATTCCGAAGACAATGATGACACTTCA
TCATCCGTTTTTACTGACAGCAGCAAAGTGGGACCCCCAAAACGTGAAATCCAAAGGACTCTGCCGATGTCCTAT
GGTCAGTCGCGTTTCTGGTTCCTAGAGCATCTTGTTGAGGACAAAACTGCATTTAATATTACACCGACATTTGAG
TTGTCTGGTCGCCTGAGAATTCAAGAATTTGCAAATGCCGTAAAAGCCACAGGACAACACCACGAAGCCCTGCGT
ACATTTTTTTTCACTGACAATGAACGGAACCATATCCAAGGCGTTTGGACGAAATCTTCGTTACAGTTGGAGCAT
GTTGCAATCTCCGACAAGGCAGAAGTTGAAGAGGCCGAGAAACAGATGAAGGCGCACGTGTTCAACCTCTCTGAT
GGCGAGGTCATGCGTGTTCAGCTGCTTTCGCTTGACCTAGAAAAGCACTGGATAATCTTCGGCTTTCATCACATC
AACATGGATGGTATTAGCTTCGAAGTATTTTGGTCAGATGTGGAAAAGGCATATCAAGGCCAACCCCTTTCTGAA
GATGGACTTCAATATCCAGACTTTACTATGCGGCAGCTTCGTGAATACGAAGAGGGCACCTGGGCTGGAGATATC
GCTTACTGGCGAGCCCAGTATACAGAGATTCCACCCACAATTCCCCTTCTTCCATTTGCTCTACAACCCATGCGC
CCTAAGGTTGCTCAATTTCGTTCCCATACTGCACATATTCGTCTCGATGTCAGTTTATCGGATTCAATTGACCGG
TGTTGCCGGATGTTCAAATCAACACCCTTCCACTTCCATTTGGCAGTCTGGAAGACCCTTCTTCTACGGTTTTTT
GATGTGAAGGAAGTTTGCATCGGCCTCGGAGATGGAAACCGTACGGATGCCGACATACTACGGAGCGTGGGACTT
TTCTTGAACCTCCTTCCTGTGAGGTTCTCTCAACAGCCAGGCCAATCTTTCGGAGAATCTCTCAAAGAGGTCAGG
AACATCACACAGGGTGCGTTTTCCCACTCGCGTGTGCCGTTTGATGTTATCTTGACAGAACTCAACGTTCCACGA
TCCGCATCTCATAATCCTCTGTGCCAAACCCTCTTCAACTATCGACCCAAGGTCGAGCAATCACGAAGCTTTTGT
GGTTGTGTAGCCGATGGCGCACTTTTGGGCGGCGGCGAAACTTCTTTCGATCTCGGTCTAGATGTTGGCAATGTC
GGTGCCGGCGAGACGCTAATTCACCTGTCTGCCCAGACTAGCTTGTATGGAATGGAGCATGCAGAAATCCTGGTC
AGTTCCTATGTCAATATCCTTCGTTCTTTCCTCCAGAATCCAGCAACCCGGGTGACCTGGCCGAAATTACATTCG
AAAGATGACATTCAAGAGGCAGTGATTGCGGGCCGAGGACCCGAGCTGCGAGATGAATGGCCTGTGACTATCGTC
CATCGCCTGGATGAGGTTGCCTCGCGTTATCCAGACCGTGTCGCATTGAGGAACCACGATGGAAACTCCTTGACC
TATAGTGAAGTCCAGCGTCGGATCGATGTTATTGCCAACGAACTCCTACGCAACGAAGTTGGCTCAGGCACCCGT
GTTGGTATTTTACAGTCTCCAAGTGCAGACTGGATATGTTCTCTCATGGCCATTTTGCGTGTCGGTGGTGTTTAC
ATTCCATTGGACACAAAGGTGGGGATGAACAGACTCGCAATGATCATGAAAGAAACACAAGCACCGATGGTATTG
GTTGATACAAAATCTATGCCTGACTATACGCTTCTGCATACGACGGCAAAACCTATCGACGTATGTAGCCTAAAC
GCCTCTACTGCACGCCCCATCCGAAACATGGCTGTCCCAAGTCAGACAGCGGTGATCATGTATACCAGCGGATCA
ACCGGTGTCCCAAAGGGAATTATGATTGCGCATTCAGCATATGTTCACCACGTTCAGTCATCCAGTGTCGTCTGG
GAACTTAAGCAGGGGAATGAGACCATCCTGCATCAATCATCATATGCTTGGGATGCGTCTTTATGGCAGATCATG
GTCTCTCTATGCTCTGCGGCGACCCTTGTGATTGCATCTGATCTCACACGAGGGGATCCCATTGCTCTCACGCGA
CTCATCGCATCAGAGAATGTGACGTGCACCCTTGCGACCCCCACCGAATATCTCGCTTGGTTGCGTTATGGTCGC
TCCCATCTGAGTAACTCTCGCTTATCAACCGCGGTATGTGGTGGTGAATTCATGCCAAGTGGGTTGATCAAAGAG
ATCAAGAATCTTCATCGGCCAGACCTCAAACTGATAAATGCCTATGGGCCGGCGGAAATCAGTGTTGCATGCTCA
GCCAGTGAAGTTCCGTACGACCTGCTGGGTTCCACATCAACATCCCCTGCGCAAGCTCTTTATACACTACCAAAC
TACTCCGTTTACATTGTCGACCAAACCTTGAACCCTGTTCCCATCGGAATTCCTGGGGAAGTGGTCGTTGGTGGT
GCAGGAGTTGCCCAGGGCTATCTTGATGGCACCAAAACAGCCGAACGATTTTCAAGTGATCGGTACGCAAGCAAA
TTTTTCCAAGAGAAAGACTGGACAACAATTCACCGCACTGGAGACCGCGGAAAGCTCAATCGCGATGGTGGTCTT
ATTCTCCTCGGGCGCATGGACGGGGATAACCAAATCAAATTGAGGGGAATTCGCATCAATATCGAAGAGATCGAG
ACGGCGATCGTCAGTTCTTCAGCTGGAGCTATCACACAAGCTGTGGTATCGGTTCGTTTAGATGCAAACCAATCT
GAGGGCGATCAATTTCTTGTTGCCTTTGTTATAATGGCTGCCACACACGAATCTGAAAATATACTTCAATTTCTC
GCCCGCCTTCTCCAGGAGCTGCCATTGCCACCTCATATGAAACCTGCTGCTATCATTCCAGTTGAAAGCATTCCC
CAAAATACCTCGGGCAAGACTGATCGCGTCGCAGTCAGCGCACTTTCCATTCCATTTATTTCATCCCAGCTGCCG
GACAACAGCACCCTCACGGCATTTGAACAATCATTGCGTCAGCTCTGGCGACAGGCACTACCACGCGAACTCAGC
AGCTTTCACTCGATTGATTCAGAATCTGACTTTTTCCACGTTGGTGGAAGCTCCCTCGCTCTTGTCAACCTGCAA
GTTCTAATCCAGGAGAAGTTCGGTACATCTATGGCATTGTATCAACTTTTCGAAGCCAGCAGTCTACGTGGAATG
GCGGCCAGAATTCAAGATATATCTCGCCCCGCACTCGAGCCGGATGTGAATTGGGATGCGGAGATTGAAGTCGCA
ACGGACCTCACTCCACCTCTGAATTATGAGAGCACCCATATTATCGCCTCGGGGGTCAAGACAGTGGTACTCACT
GGCGCAACGGGTTTCCTTGGCAAAGAAATCCTCCGAGGTCTTATACATGATGAAAACGTTTTGTCCGTTCATTGT
CTTGCTGTCAGAAAACGATCATCGGGTTTATCTGAACTATTTTCCCACCCGAAAGTTCACTTGCATTACGGTGAT
CTGGGGGCTCCTCAACTAGGACTATCTGAATCTGAGATCAAATCTATATTCTCCTGTGCAGACATCGTTATTCAC
AATGGCGCGGATGTGTCGTTCATGAAAACATATCAGACTCTCAAGCTGATCAATGTGGCATCGACGAAAGAAATC
GTCAAACTTGCATTGCCCCGGCGTATTCCATTACATTTTGTTTCGTCGGCTGGTGTTGCACGGCTTACTGGTCAA
GAAAGCTTCGGCGAGATGTCTGTATCGTCATATCCTCCTCCATCTCGACCAACAGATGGATACATCGCTGCCAAG
TGGGTGAGCGAAATATATCTCGAGCACGTCAACCGTCGATTTGGTCTGCCGGTATGGATACACCGCCCATCGAGC
ATCACCGGTACCGATGCGCCGGAACTTGATCTTATGGGTAATGTCATGCGGTTCACCAAAGAAACCCAGAAAGTG
CCAGACTCGAGCTCATGGTCAGGAGTCTTCGATCTGGTTTCCGTACAGTCGGCCGCACGCCAACTCCTCGAGGCC
GTTTACCAATCTGGTATCGCCACTACGGAGGCTGTGACGTATTTGTATGAATCTGGCGAGACGAAGATTGGACGT
GATGAAATCATGCCCTTGATGGAATCGAGCTCGGGCCAACAGTTTCAGGTCGTTTCACTCGACGAGTGGGTGAAT
GCTGCCGAACAAGCAGGAATGAGTGTGTTGTTGGGAGAGTACTTGCGCAGAGCCTCCGATGGGCAAGTCCTGCTC
CCCAGGTTGATTAAAAACAGTAGATTTTCCGAGGATGAATGA
Transcript >Pro_DTO377G3_2|g8063.t1
ATGACAGGTGGTCTTCAGCACACCGGAGAACCGATTGCCATCGTGGGAAGTGCCTGCCGCTTTCCTGGTGATGCA
ACAACACCCTCGAAACTTTGGGACTTGCTCAGATCACCACGAGATGTCCTTAGCGAGATTCCAGAAAGCCGTTTT
AGCACCAAAGCATTTTACCACCCCGATGGCCTTCACCATGGCACAACGAATGTTCGACATTCCTATTTGTTGTCC
GACGATCATCGACTGTTTGACGCCCAATTTTTTGGAACCAAGCCAGTGGAAGCAAACTCGATTGATCCGCAACAA
AGGCTCTTGCTTGAGACTGTTTACGAGGGACTCGAAACATCTGGCATTCCCATGGAAAAGCTACAAGGGTCCAAC
ACCGGCGTATATGTTGGTTTGATGACCAATGACTATGCGGATATGTTGGGTCGGGATGTGCAGAACTTCCCAACT
TATTTTGCGTCGGGAACTGCTCGAAGCATTCTATCCAATCGAGTGTCCTACTTTTTCGACTGGCGGGGACCTTCC
ATGACCATCGACACGGCATGTTCTTCTAGTCTGATTGCCCTTCACCAGGCCGTACAGAGCCTGCGAAGTGGCGAG
ACTGATGTTGCGGTAGCAGCAGGAACCAACCTTCTGCTTGGACCGGAGCAATATATCGCAGAGAGCAAGCTGAAG
ATGCTCTCCCCGACGGGCCGCTCGCGCATGTGGGATAAAGATGCAGATGGATATGCACGCGGTGACGGAATTGCT
GCCATAATACTCAAACCATTAAGTGCAGCATTGGCGAATGGAGATCACATCGAATGCATCGTTCGAGAGACAGGT
GCCAATCAAGACGGTCGTACCAAAGGAATCACGATGCCCAACCCTATGGCTCAAGCAGACCTTATTCGGACTACG
TATGCCCGAGCTGGACTAGATCTTTCCAACCCCACCGACCGGCCACAATATTTCGAAGCTCACGGTACCGGAACT
CCTGCAGGTGACCCAGTCGAGGCGGAGGCCATCAGTACTGCATTCTTTGGACAAGCAGCCAAGTATCAGCGCGAT
AGTAACCGAGAGCACCCCTTGTATGTTGGGTCAATTAAAACAGTGATCGGGCACACTGAGGGCACGGCTGGATTA
GCAGCGGTCCTCAAGGCATCACTTGCTTTACAACATGCTGTCATCCCACCAAACCTATTGCTCAATGAGTTGAGT
TCCACGGTACTTCCCTTCTACAACGACCTTGAAATCCTTCAAGTTGCGAAAGAATGGCCGCAGCTTTCAGAGAAC
ACCCCTCGTCGTGCTAGTGTCAACAGCTTTGGCTTTGGCGGCGCAAATGCGCATGCAATTTTGGAAGAATTCGAT
ACGCGCCCGCTTGCCTGTGGTCAGAACGCTGCAGATGACAGCTCCGGAGCAGTGTTACCATTCAATTTCTCTGCC
TCCTCCGAAAAGTCGCTTCTCACCAACATTGCAGCATACTCGGCGTATTTGCGAAATAATTCGGATGTCAATATC
CGTGATTTGTCATGGACATTGAACTGCCGACGTTCCACTCTGCCAGTACGTTTGTCGGTGTCTGCATCAAGCCTA
GGAGAGCTTGCTGCAGGGCTGGATGAAGCAGTACTGTCCTTGGCAATAACACCAAGCACGCAAACAGGAAGTATC
CTCGAACCGAAACTCCTTTGGGTGTTTACGGGCCAAGGAGCACAGTGGGCAAGGATGGGTGCTGAACTGCTCGAA
AGCTCGCCAATGGTCAGTGATTGTATCGCCCGACTCGATCGGTCTTTGCGGGATTTACCCACTGAGCATCGCCCT
GTTTGGTCGCTGAGGGGGGAGCTTGTGAAAGATAAGTTTTCATCCCGTATTGGGGAGGCGGCGTTTTCGCAACCT
CTCTGTACCGCGATTCAAATTGCGTTGGTTCAGCTTCTCCGAGCAGCCAATGTGAAACCCACTGCTGTCGTTGGC
CATTCGTCTGGGGAGATTGCCGCAGCGTATGCCGCGGGGTATCTCAACGAAGAGGATGCTATCCGCATTGCCTAT
TACCGCGGATGGTCTCTTCAGTATACAACTTCCCAGGGAGGACAGATAGGGGCAATGATGGCCGCGGGAACATCA
TTTGAGGATGCAAAGGAGCTTTGCGAGATGCCGTCCCTCGAGAACAGAATTTGCGTGGCAGCTAGCAACTCCTCC
GCCAGCGTCACACTTTCCGGGGACGCCGATGCGATCGATGAGGCTAGAGAAATTCTTGAAGATGAGAAAAAATTT
GCTCGCTTGTTGAAAGTGGACAAAGCTTATCACTCACATCACATGCTTTCCTGCGCAGCTCCTTATATCGCAGCG
ATCCGCACGTGCGGCATAACAGTTCAGCGTCCACCGAGTGGCAGTGCTACCTGGATTTCTAGTGTGTATGGGGAA
AACATTGACAGCGTGGATGAGAATCTTGCCGACACGTACTGGAGCAATAACATGGTCAAGCCCGTACTATTCTCC
CAGGCTGTCACTTATGCCGTTGGTGCAGCTGGGCCATTCGACATGGCTTTGGAGATTGGTCCTCACCCAGCACTG
AAAGGACCTTCAATGCAGACGATCCAAGAAGTGTCTGGCCAGACATTGCCTTACACCGGGACCCTAAATCGTGGA
AAAAAGGACAGCGAGGCTTTCTCATCCGCCCTAGGCGCCCTATGGATTGCCTTGGGTGAGGGTGTCGTGGACTTC
GCAGGGTTTGAGATGAAAGCAATGCAAAATCAAAACACTCGATCTCCAGAGCTCATAAAAGGCCTTCCATCGTAT
TCGTGGGACCATGATCGGGTTTATTGGCACGAATCTCGATCATCTACCGCAATACGCACTGAAAAGGAACCATTC
CACCCCCTATTGGGTGTCAAATGCCCCGATGGGACAGACAATGAGTTACGCTGGCGCAACTATCTTCACCCTAGG
GAGGTTCCATGGCTGGCACATCACCAGGTCCAAGGCCAAATGGTATTCCCTGCAGCTGGTTATATATCGGCGGCG
GTTGAGTGTATCATTCAAAAGTATGGCCTGGGTTCTGTGCAACTGATCGACTTCCATGATGTGGTCATCGGACAG
GCATTGGTATTGGAAGAGAACGGGGGAGTGGAAACGATTTTCAGACTTTCCATCGACCAAGTCCAGGCCGATTGC
GTGTCTGCGTCCTTTGCCTGTCATTCTGACGCTAATAAGGGGTCATCCAACATGTCTCTTCACGCATCTGCCGCC
ATACAAATTATTTTGGGTGACCCCAAGCACGATATCCTCCCACCACACGCCCACCCGCAAGGCTCATTCCTGGAT
CTGGAAGCAGACCGATTCTACAATTCAGTTTCAGAGCTTGGGTTTGGCTATACCGGCCCCTTCCAGGCCCTTTTC
AACTTGCGCAGAAAAATGGACGAGGCATCGGGTTTGATTGCTGTCCCGGTGGATTCCAAAACTGAAAGACCGTTG
ATCATTCACCCAGCCTCTCTTGACGGAGCTATTCAGTCCATCATGCTTGCTTATTCCTTTCCAGGTGATGGACGC
TTGCGCACCCTTTACCTTCCCACTCGAATTGACAGGCTTCGCCTCAATCCAACCGCCTGTGTCGCTCTTGGTGCT
TGTGGTACAGATTTGCCCTTTTATTCTGCGGTCACGGATGCCCGCTTTGCTGAACTCTCTGGCGATGTTGATATA
TTTTCAGCAGACGGGAGACATACTTTGGTTCAACTGGAAGGGCTTCATACCACACCCTTGAGTCCATTGACATCA
TCAAATGATGTTCCCTTTTTCACGGAAGTGGTATGGGATGTTGATAGACCCACCTTGCGACAACTTAAGAAAGCT
GAAGGCATGCTTCCCCAAGAGGGTTCCCTAGGCGTGGATCTCGAGCGCGTGGCACATTTCTACTTGAAAAAACTT
GAAAATTCGCTCCAGGACTTCGATCATGCAAATGCAACTTGGGACCATACACGTTTTCTCTCATATGTGGAGCAT
TGTACAACCTCTGTTGCTAATGGAAAACATAAATTCGCAAAGGCGGAATGGGCCAATGACACCATGGACGATGTT
GCTCCAATTCTGAATCGTCATTCCGACTGCATCGACATCAAAGCACTGTGTTCCGTTGGGGAGAACCTTCCTGCT
GTCATTCGCGGAGATCAGAATTTACTTGAAATCCTGATGCGCGACAATATGCTAGCGGAATTTTACGCCAAAACA
CTTGGAATAGACGCATACTTGGAAACCATCGCACAGACGGCTCGTCAGATCGGCCATAGATACCCCCATGTCAAT
GTTTTGGAGATTGGAGCTGGCGCCGGCGCTACTTCGGAACGAGTCCTTCGTGCAATGGGCTCCTCATTTACATCA
TACACATATACCGATATTTTGGACTCACAGTTCGATAACGCGCGTGAAAGATTCTCGGATTACCAATCTAGAATG
GCATTCAAGTTGTTGGACATCGAGAAAGACATCGGGGAACAAGACTATGAAGAGGGTTGTTTTGACCTTGTCATT
GCTCCTCTAGCCCTGTATGCCACCAGAAATCTTGAGTCAACCCTCACAAATGTTCGACGGCTACTAAAGCCTGGT
GGGTACCTGGTTATGCTCGAACTCACCGACTCGGATGTCATGCGCTTCGGGTTGATTTTTGGTGGCCTACCAGGC
TGGTGGTTAGGCTACAAGGAGGGACGAACCTTATCCCCTTGTATATCGGAGGAGAAATGGGAAGGATTGATGCAA
AAAACAGGATTTTCTGGTTTCGAAGCCTTGTTGTCATCTTCCAGAACCTCGCCTCTGCCATTCTCCGTCATGATT
ACCCAAGCTGTCGATCACCGCGTCAATTTTCTTCGTGATCCCCTAGCAGCGAATCATACACCACTAGGTGTGAAC
TCGTTGACAATCATCGGAGGGAAAACATCCTTGACTGCTGATATCGTAGCCGATATGAAGACTGCGGTCCGTCCC
CACTACAGCAATATCTACACAGCTGGCTCTTTAGATGACCTCGTCTCGGCAAATCTTCCCGTAATGGGGTCAGTG
ATTAGTCTGATTGAATTGGATGGGCCTGTTCTCAGGCACATGTCTCCTAATAATCTGAGGTCATTCCAAGAGCTC
TTCAAACAAAGCAAGAATGTTCTGTGGGTGGGACACGGTGCCCAGGGAGAGAATCCCTATGGCAACATGTTCACA
GGAGTTCAACGCACATTGGCCATGGAGATGACTCACCTCCATATCCATTTCCTGAACCTCCGTTCGCTTTATGAC
GCTGATTCCAATATTATCGCTACAAAGCTGCTCCATTTGGAAGCCGCCGAAATTTGGGATCAGAGTGGCCAGCTC
GATGGGATGTTGTGGTCCAACGAGAGGGAGCTGCTGCTAGAGAATGGGAATTTCAAAGTTCCTCGATTCCGCCTG
AACTCTGGTCGGAACGATCGATACAATTCCTCAAGGCGTCTTATTATTAAAGAGGTTGAACGTAAAAAATCCGTG
GTGACCATCCGACCAACTGAAATTGGATATCAAATTGAAGAAAAGGACCCTCAAGACTCGCCCTCTTTCCCGGAT
GATGTGCATATTGATGTGGCTCACTCTTTCCTCCGTGCCGTCCGCATCACTCCAACGGACAATTATTTCTTGCTG
GTTGGGAAGAATAAGTGGAATGGTGAGCGTGTGGTCGCTCTGTCGCATACTCTGGACTCTCAAGTTCGTGTGCCA
CATGGCCTGACGGTGCGATGTGGAGATTCCGAAGAGCTAGGAATTCGATCGATACTCACCCTCTATTCCCATTTC
CTTGCTCTCTCTATGCTCCAACAGCTTCAACCAGGAACAATATTGGCCGTGTTAGACCCTGGCTTCTCGCTAGCA
CCAGTCCTTACGAAATACGCAGCAGAAAAGGGTGTGCAACTTGTCCTTTTGACAACAAAGGAAGGACATTGCTCA
TGGCCATGGATCCGAATCCACCCAAACTCCACCCGGCGTGAAGTATTAAGTAAGCTACCTGGCAATATTTCACGC
CTTGTCAATATGAGTGGCAGCTCTGATGTGACTACTCTCCTGAGGACATGCTTGCGGACAGACTGTCATTTTGAG
AGCGAGAGCACTTTGACTGCAAACATCTCTCAATCTCAGTACACCTCAGATACAGGCCAATTGGCTATGCAGCTG
CAGAATACCTGGGCGAGAGCACAATACGACCTGATGCCAGTTAATATGCACAAGTTTGTTCCTCTAGGACTTGAG
GACCTGATTCGCGCACAATCTCCGCTTGCGGGCCAGTCTTTAATTGCATGGGGTCAATCGCAGCTTGCTGTCCAA
GTTCGCCCTGCTACCAAAGCTGTCAAATTCTCAAAGGACAAAACTTACTGGCTAGTTGGACTAACAGGCGGGCTC
GGTTTGTCGCTTTGCCAGTGGATGATCGGACAGGGGGCACGATACATCGCGCTATCAAGTCGAAACCCAAAGATC
GATGACCAATGGCTGCAGAGAATGGCTGCGAATGGATGCACTGTCCGAGTATTCTCCAATGACATAACGAATCGG
GAATCTGTTCAAGCAACCCATCGTAACATCAGCGAAACCATGCCTCCTATCGCGGGTGTTGCACAAGGTGCGATG
GTGCTCCAGGACACAATGTTCATTGATTTAGATCTCCCTCGCCTTGAGAAGGTTCTCCGTCCTAAAGTTGAAGGT
AGTATATTACTGGACGAATTGTTCCCAGAGGACACGTTGGAATTTATGGTTTTCTTCTCGTCGATGGCTGCGATG
ACGGGAAACCCTGGCCAGGTTGCCTATAATGCCGCGAATATGTTTATGGCGAGTCTGGCAGCCCAACGCCGAAAC
CGTGGATTGGCAGCACATGCGATCAACATCGGCGCGATTGTCGGTAACGGCTACGTTACACGAGAGCTGAACATG
GGCCAGCAATCATACCTTTACCGAGTCGGGCATTCATGGATGTCTGAACAAGACTTCCATGAGGTGTTTGCCGAA
GGTGTACTTTCTTGTAGGGAGCGTGTCGGGAGCGCTGAGTTATGCTGTGGACTCAGAATTGACGATGATGAGTCG
AAGAGTTGGGTTTCTAACCCAATTTTTCAACATCTGGTCTACAAGTCTAGCAAACTTGTGGTGACAGACAAGAAA
GGGAAATCTGGCGTGTTGATAAAAACACGCTTATTCGAGGCAACTTCAAACCAGGAAGTCATCGAGATCTTGCAA
GATAGCTTTGTTTTGAAGCTCCAGTCCGCCCTTCAGGCTGATCCCAACAAGCCTATGTTGGACATGAGTCCGGAT
GAGCTTGGTGTCGATTCATTGGTCGCTGTTGACCTTCGATCGTGGTTCCTCAAGGAGCTGGGGGTGGATATGCCG
GTGCTGAAAATCTTTAACGCGGCGTCAATTCGTGAGCTTTTGGCCACTGCTGCAGAAGTTCTGCCAGAATCTTTG
ATCCCCAATGTGATGGCAGAACAGGCTGTAAAGTCACAGGCGCACCAGCCTAACCCTTCAACACCTTCCCCCACT
TTGCCCGTGGATAAAATAGTTCCAGATACCAGAGCAAGGTCTATGGAGTCAAATTTTGCACTTCCTGATGCAACG
AATGCGTACAGTGGCAGCTCGGCGACGTCGTTATTTACCGGAGACTCGAATTCCGAAGACAATGATGACACTTCA
TCATCCGTTTTTACTGACAGCAGCAAAGTGGGACCCCCAAAACGTGAAATCCAAAGGACTCTGCCGATGTCCTAT
GGTCAGTCGCGTTTCTGGTTCCTAGAGCATCTTGTTGAGGACAAAACTGCATTTAATATTACACCGACATTTGAG
TTGTCTGGTCGCCTGAGAATTCAAGAATTTGCAAATGCCGTAAAAGCCACAGGACAACACCACGAAGCCCTGCGT
ACATTTTTTTTCACTGACAATGAACGGAACCATATCCAAGGCGTTTGGACGAAATCTTCGTTACAGTTGGAGCAT
GTTGCAATCTCCGACAAGGCAGAAGTTGAAGAGGCCGAGAAACAGATGAAGGCGCACGTGTTCAACCTCTCTGAT
GGCGAGGTCATGCGTGTTCAGCTGCTTTCGCTTGACCTAGAAAAGCACTGGATAATCTTCGGCTTTCATCACATC
AACATGGATGGTATTAGCTTCGAAGTATTTTGGTCAGATGTGGAAAAGGCATATCAAGGCCAACCCCTTTCTGAA
GATGGACTTCAATATCCAGACTTTACTATGCGGCAGCTTCGTGAATACGAAGAGGGCACCTGGGCTGGAGATATC
GCTTACTGGCGAGCCCAGTATACAGAGATTCCACCCACAATTCCCCTTCTTCCATTTGCTCTACAACCCATGCGC
CCTAAGGTTGCTCAATTTCGTTCCCATACTGCACATATTCGTCTCGATGTCAGTTTATCGGATTCAATTGACCGG
TGTTGCCGGATGTTCAAATCAACACCCTTCCACTTCCATTTGGCAGTCTGGAAGACCCTTCTTCTACGGTTTTTT
GATGTGAAGGAAGTTTGCATCGGCCTCGGAGATGGAAACCGTACGGATGCCGACATACTACGGAGCGTGGGACTT
TTCTTGAACCTCCTTCCTGTGAGGTTCTCTCAACAGCCAGGCCAATCTTTCGGAGAATCTCTCAAAGAGGTCAGG
AACATCACACAGGGTGCGTTTTCCCACTCGCGTGTGCCGTTTGATGTTATCTTGACAGAACTCAACGTTCCACGA
TCCGCATCTCATAATCCTCTGTGCCAAACCCTCTTCAACTATCGACCCAAGGTCGAGCAATCACGAAGCTTTTGT
GGTTGTGTAGCCGATGGCGCACTTTTGGGCGGCGGCGAAACTTCTTTCGATCTCGGTCTAGATGTTGGCAATGTC
GGTGCCGGCGAGACGCTAATTCACCTGTCTGCCCAGACTAGCTTGTATGGAATGGAGCATGCAGAAATCCTGGTC
AGTTCCTATGTCAATATCCTTCGTTCTTTCCTCCAGAATCCAGCAACCCGGGTGACCTGGCCGAAATTACATTCG
AAAGATGACATTCAAGAGGCAGTGATTGCGGGCCGAGGACCCGAGCTGCGAGATGAATGGCCTGTGACTATCGTC
CATCGCCTGGATGAGGTTGCCTCGCGTTATCCAGACCGTGTCGCATTGAGGAACCACGATGGAAACTCCTTGACC
TATAGTGAAGTCCAGCGTCGGATCGATGTTATTGCCAACGAACTCCTACGCAACGAAGTTGGCTCAGGCACCCGT
GTTGGTATTTTACAGTCTCCAAGTGCAGACTGGATATGTTCTCTCATGGCCATTTTGCGTGTCGGTGGTGTTTAC
ATTCCATTGGACACAAAGGTGGGGATGAACAGACTCGCAATGATCATGAAAGAAACACAAGCACCGATGGTATTG
GTTGATACAAAATCTATGCCTGACTATACGCTTCTGCATACGACGGCAAAACCTATCGACGTATGTAGCCTAAAC
GCCTCTACTGCACGCCCCATCCGAAACATGGCTGTCCCAAGTCAGACAGCGGTGATCATGTATACCAGCGGATCA
ACCGGTGTCCCAAAGGGAATTATGATTGCGCATTCAGCATATGTTCACCACGTTCAGTCATCCAGTGTCGTCTGG
GAACTTAAGCAGGGGAATGAGACCATCCTGCATCAATCATCATATGCTTGGGATGCGTCTTTATGGCAGATCATG
GTCTCTCTATGCTCTGCGGCGACCCTTGTGATTGCATCTGATCTCACACGAGGGGATCCCATTGCTCTCACGCGA
CTCATCGCATCAGAGAATGTGACGTGCACCCTTGCGACCCCCACCGAATATCTCGCTTGGTTGCGTTATGGTCGC
TCCCATCTGAGTAACTCTCGCTTATCAACCGCGGTATGTGGTGGTGAATTCATGCCAAGTGGGTTGATCAAAGAG
ATCAAGAATCTTCATCGGCCAGACCTCAAACTGATAAATGCCTATGGGCCGGCGGAAATCAGTGTTGCATGCTCA
GCCAGTGAAGTTCCGTACGACCTGCTGGGTTCCACATCAACATCCCCTGCGCAAGCTCTTTATACACTACCAAAC
TACTCCGTTTACATTGTCGACCAAACCTTGAACCCTGTTCCCATCGGAATTCCTGGGGAAGTGGTCGTTGGTGGT
GCAGGAGTTGCCCAGGGCTATCTTGATGGCACCAAAACAGCCGAACGATTTTCAAGTGATCGGTACGCAAGCAAA
TTTTTCCAAGAGAAAGACTGGACAACAATTCACCGCACTGGAGACCGCGGAAAGCTCAATCGCGATGGTGGTCTT
ATTCTCCTCGGGCGCATGGACGGGGATAACCAAATCAAATTGAGGGGAATTCGCATCAATATCGAAGAGATCGAG
ACGGCGATCGTCAGTTCTTCAGCTGGAGCTATCACACAAGCTGTGGTATCGGTTCGTTTAGATGCAAACCAATCT
GAGGGCGATCAATTTCTTGTTGCCTTTGTTATAATGGCTGCCACACACGAATCTGAAAATATACTTCAATTTCTC
GCCCGCCTTCTCCAGGAGCTGCCATTGCCACCTCATATGAAACCTGCTGCTATCATTCCAGTTGAAAGCATTCCC
CAAAATACCTCGGGCAAGACTGATCGCGTCGCAGTCAGCGCACTTTCCATTCCATTTATTTCATCCCAGCTGCCG
GACAACAGCACCCTCACGGCATTTGAACAATCATTGCGTCAGCTCTGGCGACAGGCACTACCACGCGAACTCAGC
AGCTTTCACTCGATTGATTCAGAATCTGACTTTTTCCACGTTGGTGGAAGCTCCCTCGCTCTTGTCAACCTGCAA
GTTCTAATCCAGGAGAAGTTCGGTACATCTATGGCATTGTATCAACTTTTCGAAGCCAGCAGTCTACGTGGAATG
GCGGCCAGAATTCAAGATATATCTCGCCCCGCACTCGAGCCGGATGTGAATTGGGATGCGGAGATTGAAGTCGCA
ACGGACCTCACTCCACCTCTGAATTATGAGAGCACCCATATTATCGCCTCGGGGGTCAAGACAGTGGTACTCACT
GGCGCAACGGGTTTCCTTGGCAAAGAAATCCTCCGAGGTCTTATACATGATGAAAACGTTTTGTCCGTTCATTGT
CTTGCTGTCAGAAAACGATCATCGGGTTTATCTGAACTATTTTCCCACCCGAAAGTTCACTTGCATTACGGTGAT
CTGGGGGCTCCTCAACTAGGACTATCTGAATCTGAGATCAAATCTATATTCTCCTGTGCAGACATCGTTATTCAC
AATGGCGCGGATGTGTCGTTCATGAAAACATATCAGACTCTCAAGCTGATCAATGTGGCATCGACGAAAGAAATC
GTCAAACTTGCATTGCCCCGGCGTATTCCATTACATTTTGTTTCGTCGGCTGGTGTTGCACGGCTTACTGGTCAA
GAAAGCTTCGGCGAGATGTCTGTATCGTCATATCCTCCTCCATCTCGACCAACAGATGGATACATCGCTGCCAAG
TGGGTGAGCGAAATATATCTCGAGCACGTCAACCGTCGATTTGGTCTGCCGGTATGGATACACCGCCCATCGAGC
ATCACCGGTACCGATGCGCCGGAACTTGATCTTATGGGTAATGTCATGCGGTTCACCAAAGAAACCCAGAAAGTG
CCAGACTCGAGCTCATGGTCAGGAGTCTTCGATCTGGTTTCCGTACAGTCGGCCGCACGCCAACTCCTCGAGGCC
GTTTACCAATCTGGTATCGCCACTACGGAGGCTGTGACGTATTTGTATGAATCTGGCGAGACGAAGATTGGACGT
GATGAAATCATGCCCTTGATGGAATCGAGCTCGGGCCAACAGTTTCAGGTCGTTTCACTCGACGAGTGGGTGAAT
GCTGCCGAACAAGCAGGAATGAGTGTGTTGTTGGGAGAGTACTTGCGCAGAGCCTCCGATGGGCAAGTCCTGCTC
CCCAGGTTGATTAAAAACAGTAGATTTTCCGAGGATGAATGA
Gene >Pro_DTO377G3_2|g8063.t1
ATGACAGGTGGTCTTCAGCACACCGGAGAACCGATTGCCATCGTGGGAAGTGCCTGCCGCTTTCCTGGTGATGCA
ACAACACCCTCGAAACTTTGGGACTTGCTCAGATCACCACGAGATGTCCTTAGCGAGATTCCAGAAAGCCGTTTT
AGCACCAAAGCATTTTACCACCCCGATGGCCTTCACCATGGCACAACGAATGTTCGACATTCCTATTTGTTGTCC
GACGATCATCGACTGTTTGACGCCCAATTTTTTGGAACCAAGCCAGTGGAAGCAAACTCGATTGATCCGCAACAA
AGGCTCTTGCTTGAGACTGTTTACGAGGGACTCGAAACATCTGGCATTCCCATGGAAAAGCTACAAGGGTCCAAC
ACCGGCGTATATGTTGGTTTGATGACCAATGACTATGCGGATATGTTGGGTCGGGATGTGCAGAACTTCCCAACT
TATTTTGCGTCGGGAACTGCTCGAAGCATTCTATCCAATCGAGTGTCCTACTTTTTCGACTGGCGGGGACCTTCC
ATGACCATCGACACGGCATGTTCTTCTAGTCTGATTGCCCTTCACCAGGCCGTACAGAGCCTGCGAAGTGGCGAG
ACTGATGTTGCGGTAGCAGCAGGAACCAACCTTCTGCTTGGACCGGAGCAATATATCGCAGAGAGCAAGCTGAAG
ATGCTCTCCCCGACGGGCCGCTCGCGCATGTGGGATAAAGATGCAGATGGATATGCACGCGGTGACGGAATTGCT
GCCATAATACTCAAACCATTAAGTGCAGCATTGGCGAATGGAGATCACATCGAATGCATCGTTCGAGAGACAGGT
GCCAATCAAGACGGTCGTACCAAAGGAATCACGATGCCCAACCCTATGGCTCAAGCAGACCTTATTCGGACTACG
TATGCCCGAGCTGGACTAGATCTTTCCAACCCCACCGACCGGCCACAATATTTCGAAGCTCACGGTACCGGTAAG
TTATAACTGAAATGAAGGTGAAACCGAGTGTTGTAGGGCTTTGCTGACCGAACCAGGAACTCCTGCAGGTGACCC
AGTCGAGGCGGAGGCCATCAGTACTGCATTCTTTGGACAAGCAGCCAAGTATCAGCGCGATAGTAACCGAGAGCA
CCCCTTGTATGTTGGGTCAATTAAAACAGTGATCGGGCACACTGAGGGCACGGCTGGATTAGCAGCGGTCCTCAA
GGCATCACTTGCTTTACAACATGCTGTCATCCCACCAAACCTATTGCTCAATGAGTTGAGTTCCACGGTACTTCC
CTTCTACAACGACCTTGAAATCCTTCAAGTTGCGAAAGAATGGCCGCAGCTTTCAGAGAACACCCCTCGTCGTGC
TAGTGTCAACAGCTTTGGCTTTGGCGGCGCAAATGCGCATGCAATTTTGGAAGAATTCGATACGCGCCCGCTTGC
CTGTGGTCAGAACGCTGCAGATGACAGCTCCGGAGCAGTGTTACCATTCAATTTCTCTGCCTCCTCCGAAAAGTC
GCTTCTCACCAACATTGCAGCATACTCGGCGTATTTGCGAAATAATTCGGATGTCAATATCCGTGATTTGTCATG
GACATTGAACTGCCGACGTTCCACTCTGCCAGTACGTTTGTCGGTGTCTGCATCAAGCCTAGGAGAGCTTGCTGC
AGGGCTGGATGAAGCAGTACTGTCCTTGGCAATAACACCAAGCACGCAAACAGGAAGTATCCTCGAACCGAAACT
CCTTTGGGTGTTTACGGGCCAAGGAGCACAGTGGGCAAGGATGGGTGCTGAACTGCTCGAAAGCTCGCCAATGGT
CAGTGATTGTATCGCCCGACTCGATCGGTCTTTGCGGGATTTACCCACTGAGCATCGCCCTGTTTGGTCGCTGAG
GGGGGAGCTTGTGAAAGATAAGTTTTCATCCCGTATTGGGGAGGCGGCGTTTTCGCAACCTCTCTGTACCGCGAT
TCAAATTGCGTTGGTTCAGCTTCTCCGAGCAGCCAATGTGAAACCCACTGCTGTCGTTGGCCATTCGTCTGGGGA
GATTGCCGCAGCGTATGCCGCGGGGTATCTCAACGAAGAGGATGCTATCCGCATTGCCTATTACCGCGGATGGTC
TCTTCAGTATACAACTTCCCAGGGAGGACAGATAGGGGCAATGATGGCCGCGGGAACATCATTTGAGGATGCAAA
GGAGCTTTGCGAGATGCCGTCCCTCGAGAACAGAATTTGCGTGGCAGCTAGCAACTCCTCCGCCAGCGTCACACT
TTCCGGGGACGCCGATGCGATCGATGAGGCTAGAGAAATTCTTGAAGATGAGAAAAAATTTGCTCGCTTGTTGAA
AGTGGACAAAGCTTATCACTCACATCACATGCTTTCCTGCGCAGCTCCTTATATCGCAGCGATCCGCACGTGCGG
CATAACAGTTCAGCGTCCACCGAGTGGCAGTGCTACCTGGATTTCTAGTGTGTATGGGGAAAACATTGACAGCGT
GGATGAGAATCTTGCCGACACGTACTGGAGCAATAACATGGTCAAGCCCGTACTATTCTCCCAGGCTGTCACTTA
TGCCGTTGGTGCAGCTGGGCCATTCGACATGGCTTTGGAGATTGGTCCTCACCCAGCACTGAAAGGACCTTCAAT
GCAGACGATCCAAGAAGTGTCTGGCCAGACATTGCCTTACACCGGGACCCTAAATCGTGGAAAAAAGGACAGCGA
GGCTTTCTCATCCGCCCTAGGCGCCCTATGGATTGCCTTGGGTGAGGGTGTCGTGGACTTCGCAGGGTTTGAGAT
GAAAGCAATGCAAAATCAAAACACTCGATCTCCAGAGCTCATAAAAGGCCTTCCATCGTATTCGTGGGACCATGA
TCGGGTTTATTGGCACGAATCTCGATCATCTACCGCAATACGCACTGAAAAGGAACCATTCCACCCCCTATTGGG
TGTCAAATGCCCCGATGGGACAGACAATGAGTTACGCTGGCGCAACTATCTTCACCCTAGGGAGGTTCCATGGCT
GGCACATCACCAGGTCCAAGGCCAAATGGTATTCCCTGCAGCTGGTTATATATCGGCGGCGGTTGAGTGTATCAT
TCAAAAGTATGGCCTGGGTTCTGTGCAACTGATCGACTTCCATGATGTGGTCATCGGACAGGCATTGGTATTGGA
AGAGAACGGGGGAGTGGAAACGATTTTCAGACTTTCCATCGACCAAGTCCAGGCCGATTGCGTGTCTGCGTCCTT
TGCCTGTCATTCTGACGCTAATAAGGGGTCATCCAACATGTCTCTTCACGCATCTGCCGCCATACAAATTATTTT
GGGTGACCCCAAGCACGATATCCTCCCACCACACGCCCACCCGCAAGGCTCATTCCTGGATCTGGAAGCAGACCG
ATTCTACAATTCAGTTTCAGAGCTTGGGTTTGGCTATACCGGCCCCTTCCAGGCCCTTTTCAACTTGCGCAGAAA
AATGGACGAGGCATCGGGTTTGATTGCTGTCCCGGTGGATTCCAAAACTGAAAGACCGTTGATCATTCACCCAGC
CTCTCTTGACGGAGCTATTCAGTCCATCATGCTTGCTTATTCCTTTCCAGGTGATGGACGCTTGCGCACCCTTTA
CCTTCCCACTCGAATTGACAGGCTTCGCCTCAATCCAACCGCCTGTGTCGCTCTTGGTGCTTGTGGTACAGATTT
GCCCTTTTATTCTGCGGTCACGGATGCCCGCTTTGCTGAACTCTCTGGCGATGTTGATATATTTTCAGCAGACGG
GAGACATACTTTGGTTCAACTGGAAGGGCTTCATACCACACCCTTGAGTCCATTGACATCATCAAATGATGTTCC
CTTTTTCACGGAAGTGGTATGGGATGTTGATAGACCCACCTTGCGACAACTTAAGAAAGCTGAAGGCATGCTTCC
CCAAGAGGGTTCCCTAGGCGTGGATCTCGAGCGCGTGGCACATTTCTACTTGAAAAAACTTGAAAATTCGCTCCA
GGACTTCGATCATGCAAATGCAACTTGGGACCATACACGTTTTCTCTCATATGTGGAGCATTGTACAACCTCTGT
TGCTAATGGAAAACATAAATTCGCAAAGGCGGAATGGGCCAATGACACCATGGACGATGTTGCTCCAATTCTGAA
TCGGTGAGAACTTGAACTCTTGTTTACCTAACAAACTGAAATTGAATCACACTGACTGATCTACATAGTCATTCC
GACTGCATCGACATCAAAGCACTGTGTTCCGTTGGGGAGAACCTTCCTGCTGTCATTCGCGGAGATCAGAATTTA
CTTGAAATCCTGATGCGCGACAATATGCTAGCGGAATTTTACGCCAAAACACTTGGAATAGACGCATACTTGGAA
ACCATCGCACAGACGGCTCGTCAGATCGGCCATAGATACCCCCATGTCAATGTTTTGGAGATTGGTTAGTCCACA
CACATTTGAAATTGTGTGCAATACTAATTTATTACAGGAGCTGGCGCCGGCGCTACTTCGGAACGAGTCCTTCGT
GCAATGGGCTCCTCATTTACATCATACACATATACCGATATTTTGGACTCACAGTTCGATAACGCGCGTGAAAGA
TTCTCGGATTACCAATCTAGAATGGCATTCAAGTTGTTGGACATCGAGAAAGACATCGGGGAACAAGACTATGAA
GAGGGTTGTTTTGACCTTGTCATTGCTCCTCTAGCCCTGTATGCCACCAGAAATCTTGAGTCAACCCTCACAAAT
GTTCGACGGCTACTAAAGCCTGGTGGGTACCTGGTTATGCTCGAACTCACCGACTCGGATGTCATGCGCTTCGGG
TTGATTTTTGGTGGCCTACCAGGCTGGTGGTTAGGCTACAAGGAGGGACGAACCTTATCCCCTTGTATATCGGAG
GAGAAATGGGAAGGATTGATGCAAAAAACAGGATTTTCTGGTTTCGAAGCCTTGTTGTCATCTTCCAGAACCTCG
CCTCTGCCATTCTCCGTCATGATTACCCAAGCTGTCGATCACCGCGTCAATTTTCTTCGTGATCCCCTAGCAGCG
AATCATACACCACTAGGTGTGAACTCGTTGACAATCATCGGAGGGAAAACATCCTTGACTGCTGATATCGTAGCC
GATATGAAGACTGCGGTCCGTCCCCACTACAGCAATATCTACACAGCTGGCTCTTTAGATGACCTCGTCTCGGCA
AATCTTCCCGTAATGGGGTCAGTGATTAGTCTGATTGAATTGGATGGGCCTGTTCTCAGGCACATGTCTCCTAAT
AATCTGAGGTCATTCCAAGAGCTCTTCAAACAAAGCAAGAATGTTCTGTGGGTGGGACACGGTGCCCAGGGAGAG
AATCCCTATGGCAACATGTTCACAGGAGTTCAACGCACATTGGCCATGGAGATGACTCACCTCCATATCCATTTC
CTGAACCTCCGTTCGCTTTATGACGCTGATTCCAATATTATCGCTACAAAGCTGCTCCATTTGGAAGCCGCCGAA
ATTTGGGATCAGAGTGGCCAGCTCGATGGGATGTTGTGGTCCAACGAGAGGGAGCTGCTGCTAGAGAATGGGAAT
TTCAAAGTTCCTCGATTCCGCCTGAACTCTGGTCGGAACGATCGATACAATTCCTCAAGGCGTCTTATTATTAAA
GAGGTTGAACGTAAAAAATCCGTGGTGACCATCCGACCAACTGAAATTGGATATCAAATTGAAGAAAAGGACCCT
CAAGACTCGCCCTCTTTCCCGGATGATGTGCATATTGATGTGGCTCACTCTTTCCTCCGTGCCGTCCGCATCACT
CCAACGGACAATTATTTCTTGCTGGTTGGGAAGAATAAGTGGAATGGTGAGCGTGTGGTCGCTCTGTCGCATACT
CTGGACTCTCAAGTTCGTGTGCCACATGGCCTGACGGTGCGATGTGGAGATTCCGAAGAGCTAGGAATTCGATCG
ATACTCACCCTCTATTCCCATTTCCTTGCTCTCTCTATGCTCCAACAGCTTCAACCAGGAACAATATTGGCCGTG
TTAGACCCTGGCTTCTCGCTAGCACCAGTCCTTACGAAATACGCAGCAGAAAAGGGTGTGCAACTTGTCCTTTTG
ACAACAAAGGAAGGACATTGCTCATGGCCATGGATCCGAATCCACCCAAACTCCACCCGGCGTGAAGTATTAAGT
AAGCTACCTGGCAATATTTCACGCCTTGTCAATATGAGTGGCAGCTCTGATGTGACTACTCTCCTGAGGACATGC
TTGCGGACAGACTGTCATTTTGAGAGCGAGAGCACTTTGACTGCAAACATCTCTCAATCTCAGTACACCTCAGAT
ACAGGCCAATTGGCTATGCAGCTGCAGAATACCTGGGCGAGAGCACAATACGACCTGATGCCAGTTAATATGCAC
AAGTTTGTTCCTCTAGGACTTGAGGACCTGATTCGCGCACAATCTCCGCTTGCGGGCCAGTCTTTAATTGCATGG
GGTCAATCGCAGCTTGCTGTCCAAGTTCGCCCTGCTACCAAAGCTGTCAAATTCTCAAAGGACAAAACTTACTGG
CTAGTTGGACTAACAGGCGGGCTCGGTTTGTCGCTTTGCCAGTGGATGATCGGACAGGGGGCACGATACATCGCG
CTATCAAGTCGAAACCCAAAGATCGATGACCAATGGCTGCAGAGAATGGCTGCGAATGGATGCACTGTCCGAGTA
TTCTCCAAGTAAGCTCTTGTTTGGTTCCAATCACTCACGCCTGGCTAACACATGCAGTGACATAACGAATCGGGA
ATCTGTTCAAGCAACCCATCGTAACATCAGCGAAACCATGCCTCCTATCGCGGGTGTTGCACAAGGTGCGATGGT
GCTCCAGGACACAATGTTCATTGATTTAGATCTCCCTCGCCTTGAGAAGGTTCTCCGTCCTAAAGTTGAAGGTAG
TATATTACTGGACGAATTGTTCCCAGAGGACACGTTGGAATTTATGGTTTTCTTCTCGTCGATGGCTGCGATGAC
GGGAAACCCTGGCCAGGTTGCCTATAATGCCGCGAATATGTTTATGGCGAGTCTGGCAGCCCAACGCCGAAACCG
TGGATTGGCAGCACATGCGATCAACATCGGCGCGATTGTCGGTAACGGCTACGTTACACGAGAGCTGAACATGGG
CCAGCAATCATACCTTTACCGAGTCGGGCATTCATGGATGTCTGAACAAGACTTCCATGAGGTGTTTGCCGAAGG
TGTACTTTCTTGTAGGGAGCGTGTCGGGAGCGCTGAGTTATGCTGTGGACTCAGAATTGACGATGATGAGTCGAA
GAGTTGGGTTTCTAACCCAATTTTTCAACATCTGGTCTACAAGTCTAGCAAACTTGTGGTGACAGACAAGAAAGG
GAAATCTGGCGTGTTGATAAAAACACGCTTATTCGAGGCAACTTCAAACCAGGAAGTCATCGAGATCTTGCAAGG
TACAGGCATCCCAAGTTAGATACCCAGCTGAAACTAACAGCTGTCTTTAGATAGCTTTGTTTTGAAGCTCCAGTC
CGCCCTTCAGGCTGATCCCAACAAGCCTATGTTGGACATGAGTCCGGATGAGCTTGGTGTCGATTCATTGGTCGC
TGTTGACCTTCGATCGTGGTTCCTCAAGGAGCTGGGGGTGGATATGCCGGTGCTGAAAATCTTTAACGCGGCGTC
AATTCGTGAGCTTTTGGCCACTGCTGCAGAAGTTCTGCCAGAATCTTTGATCCCCAATGTGATGGCAGAACAGGC
TGTAAAGTCACAGGCGCACCAGCCTAACCCTTCAACACCTTCCCCCACTTTGCCCGTGGATAAAATAGTTCCAGA
TACCAGAGCAAGGTCTATGGAGTCAAATTTTGCACTTCCTGATGCAACGAATGCGTACAGTGGCAGCTCGGCGAC
GTCGTTATTTACCGGAGACTCGAATTCCGAAGACAATGATGACACTTCATCATCCGTTTTTACTGACAGCAGCAA
AGTGGGACCCCCAAAACGTGAAATCCAAAGGACTCTGCCGATGTCCTATGGTCAGTCGCGTTTCTGGTTCCTAGA
GCATCTTGTTGAGGACAAAACTGCATTTAATATTACACCGACATTTGAGTTGTCTGGTCGCCTGAGAATTCAAGA
ATTTGCAAATGCCGTAAAAGCCACAGGACAACACCACGAAGCCCTGCGTACATTTTTTTTCACTGACAATGAACG
GAACCATATCCAAGGCGTTTGGACGAAATCTTCGTTACAGTTGGAGCATGTTGCAATCTCCGACAAGGCAGAAGT
TGAAGAGGCCGAGAAACAGATGAAGGCGCACGTGTTCAACCTCTCTGATGGCGAGGTCATGCGTGTTCAGCTGCT
TTCGCTTGACCTAGAAAAGCACTGGATAATCTTCGGCTTTCATCACATCAACATGGATGGTATTAGCTTCGAAGT
ATTTTGGTCAGATGTGGAAAAGGCATATCAAGGCCAACCCCTTTCTGAAGATGGACTTCAATATCCAGACTTTAC
TATGCGGCAGCTTCGTGAATACGAAGAGGGCACCTGGGCTGGAGATATCGCTTACTGGCGAGCCCAGTATACAGA
GATTCCACCCACAATTCCCCTTCTTCCATTTGCTCTACAACCCATGCGCCCTAAGGTTGCTCAATTTCGTTCCCA
TACTGCACATATTCGTCTCGATGTCAGTTTATCGGATTCAATTGACCGGTGTTGCCGGATGTTCAAATCAACACC
CTTCCACTTCCATTTGGCAGTCTGGAAGACCCTTCTTCTACGGTTTTTTGATGTGAAGGAAGTTTGCATCGGCCT
CGGAGATGGAAACCGTACGGATGCCGACATACTACGGAGCGTGGGACTTTTCTTGAACCTCCTTCCTGTGAGGTT
CTCTCAACAGCCAGGCCAATCTTTCGGAGAATCTCTCAAAGAGGTCAGGAACATCACACAGGGTGCGTTTTCCCA
CTCGCGTGTGCCGTTTGATGTTATCTTGACAGAACTCAACGTTCCACGATCCGCATCTCATAATCCTCTGTGCCA
AACCCTCTTCAACTATCGACCCAAGGTCGAGCAATCACGAAGCTTTTGTGGTTGTGTAGCCGATGGCGCACTTTT
GGGCGGCGGCGAAACTTCTTTCGATCTCGGTCTAGATGTTGGCAATGTCGGTGCCGGCGAGACGCTAATTCACCT
GTCTGCCCAGACTAGCTTGTATGGAATGGAGCATGCAGAAATCCTGGTCAGTTCCTATGTCAATATCCTTCGTTC
TTTCCTCCAGAATCCAGCAACCCGGGTGACCTGGCCGAAATTACATTCGAAAGATGACATTCAAGAGGCAGTGAT
TGCGGGCCGAGGCAAGTCAATCATCCCTTACTAGTTGTAGGTCATTTGCTAAATATGGTATTATGCAGGACCCGA
GCTGCGAGATGAATGGCCTGTGACTATCGTCCATCGCCTGGATGAGGTTGCCTCGCGTTATCCAGACCGTGTCGC
ATTGAGGAACCACGATGGAAACTCCTTGACCTATAGTGAAGTCCAGCGTCGGATCGATGTTATTGCCAACGAACT
CCTACGCAACGAAGTTGGCTCAGGCACCCGTGTTGGTATTTTACAGTCTCCAAGTGCAGACTGGATATGTTCTCT
CATGGCCATTTTGCGTGTCGGTGGTGTTTACATTCCATTGGACACAAAGGTGGGGATGAACAGACTCGCAATGAT
CATGAAAGAAACACAAGCACCGATGGTATTGGTTGATACAAAATCTATGCCTGACTATACGCTTCTGCATACGAC
GGCAAAACCTATCGACGTATGTAGCCTAAACGCCTCTACTGCACGCCCCATCCGAAACATGGCTGTCCCAAGTCA
GACAGCGGTGATCATGTATACCAGCGGATCAACCGGTGTCCCAAAGGGAATTATGATTGCGCATTCAGCATATGT
TCACCACGTTCAGTCATCCAGTGTCGTCTGGGAACTTAAGCAGGGGAATGAGACCATCCTGCATCAATCATCATA
TGCTTGGGATGCGTCTTTATGGCAGATCATGGTCTCTCTATGCTCTGCGGCGACCCTTGTGATTGCATCTGATCT
CACACGAGGGGATCCCATTGCTCTCACGCGACTCATCGCATCAGAGAATGTGACGTGCACCCTTGCGACCCCCAC
CGAATATCTCGCTTGGTTGCGTTATGGTCGCTCCCATCTGAGTAACTCTCGCTTATCAACCGCGGTATGTGGTGG
TGAATTCATGCCAAGTGGGTTGATCAAAGAGATCAAGAATCTTCATCGGCCAGACCTCAAACTGATAAATGCCTA
TGGGCCGGCGGAAATCAGTGTTGCATGCTCAGCCAGTGAAGTTCCGTACGACCTGCTGGGTTCCACATCAACATC
CCCTGCGCAAGCTCTTTATACACTACCAAACTACTCCGTTTACATTGTCGACCAAACCTTGAACCCTGTTCCCAT
CGGAATTCCTGGGGAAGTGGTCGTTGGTGGTGCAGGAGTTGCCCAGGGCTATCTTGATGGCACCAAAACAGCCGA
ACGATTTTCAAGTGATCGGTACGCAAGCAAATTTTTCCAAGAGAAAGACTGGACAACAATTCACCGCACTGGAGA
CCGCGGAAAGCTCAATCGCGATGGTGGTCTTATTCTCCTCGGGCGCATGGACGGGGATAACCAAATCAAATTGAG
GGGAATTCGCATCAATATCGAAGAGATCGAGACGGCGATCGTCAGTTCTTCAGCTGGAGCTATCACACAAGCTGT
GGTATCGGTTCGTTTAGATGCAAACCAATCTGAGGGCGATCAATTTCTTGTTGCCTTTGTTATAATGGCTGCCAC
ACACGAATCTGAAAATATACTTCAATTTCTCGCCCGCCTTCTCCAGGAGCTGCCATTGCCACCTCATATGAAACC
TGCTGCTATCATTCCAGTTGAAAGCATTCCCCAAAATACCTCGGGCAAGACTGATCGCGTCGCAGTCAGCGCACT
TTCCATTCCATTTATTTCATCCCAGCTGCCGGACAACAGCACCCTCACGGCATTTGAACAATCATTGCGTCAGCT
CTGGCGACAGGCACTACCACGCGAACTCAGCAGCTTTCACTCGATTGATTCAGAATCTGACTTTTTCCACGTTGG
TGGAAGCTCCCTCGCTCTTGTCAACCTGCAAGTTCTAATCCAGGAGAAGTTCGGTACATCTATGGCATTGTATCA
ACTTTTCGAAGCCAGCAGTCTACGTGGAATGGCGGCCAGAATTCAAGATATATCTCGCCCCGCACTCGAGCCGGA
TGTGAATTGGGATGCGGAGATTGAAGTCGCAACGGACCTCACTCCACCTCTGAATTATGAGAGCACCCATATTAT
CGCCTCGGGGGTCAAGACAGTGGTACTCACTGGCGCAACGGGTTTCCTTGGCAAAGAAATCCTCCGAGGTCTTAT
ACATGATGAAAACGTTTTGTCCGTTCATTGTCTTGCTGTCAGAAAACGATCATCGGGTTTATCTGAACTATTTTC
CCACCCGAAAGTTCACTTGCATTACGGTGATCTGGGGGCTCCTCAACTAGGACTATCTGAATCTGAGATCAAATC
TATATTCTCCTGTGCAGACATCGTTATTCACAATGGCGCGGATGTGTCGTTCATGAAAACATATCAGACTCTCAA
GCTGATCAATGTGGCATCGACGAAAGAAATCGTCAAACTTGCATTGCCCCGGCGTATTCCATTACATTTTGTTTC
GTCGGCTGGTGTTGCACGGCTTACTGGTCAAGAAAGCTTCGGCGAGATGTCTGTATCGTCATATCCTCCTCCATC
TCGACCAACAGATGGATACATCGCTGCCAAGTGGGTGAGCGAAATATATCTCGAGCACGTCAACCGTCGATTTGG
TCTGCCGGTATGGATACACCGCCCATCGAGCATCACCGGTACCGATGCGCCGGAACTTGATCTTATGGGTAATGT
CATGCGGTTCACCAAAGAAACCCAGAAAGTGCCAGACTCGAGCTCATGGTCAGGAGTCTTCGATCTGGTTTCCGT
ACAGTCGGCCGCACGCCAACTCCTCGAGGCCGTTTACCAATCTGGTATCGCCACTACGGAGGCTGTGACGTATTT
GTATGAATCTGGCGAGACGAAGATTGGACGTGATGAAATCATGCCCTTGATGGAATCGAGCTCGGGCCAACAGTT
TCAGGTCGTTTCACTCGACGAGTGGGTGAATGCTGCCGAACAAGCAGGAATGAGTGTGTTGTTGGGAGAGTACTT
GCGCAGAGCCTCCGATGGGCAAGTCCTGCTCCCCAGGTTGATTAAAAACAGTAGATTTTCCGAGGATGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail