Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8053.t1
Gene name
Locationscaffold_28:232101..232563
Strand+
Gene length (bp)462
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 864.83 517.35 1212.31
5d_25C Five days - 25 degrees Celsius 565.53 323.06 808.01
7d_25C Seven days - 25 degrees Celsius 407.14 211.26 603.02
10d_25C Ten days - 25 degrees Celsius 231.47 105.56 357.38
7d_15C Seven days - 15 degrees Celsius 528.56 236.59 820.54
7d_30C Seven days - 30 degrees Celsius 470.94 258.33 683.55

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.055667 no
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.061799 no
3d_25C 7d_30C 0.006000 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.214422 no
5d_25C 7d_15C 0.864559 no
5d_25C 7d_30C 0.524365 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.425586 no
7d_25C 7d_30C 0.661125 no
7d_25C 10d_25C 0.045367 yes
7d_15C 7d_30C 0.751972 no
7d_15C 10d_25C 0.003625 yes
7d_30C 10d_25C 0.008807 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8053.t1
MYGLKQLSLLSLMLLSASAAKNPKRTLVGIETADKSRGIDVPLNDCHPIEEEDVLTVSLKKPCRLFTGPDCTGHN
TFLSPGDHSSKDPIPVIESIFCQSSF*
Coding >Pro_DTO377G3_2|g8053.t1
ATGTACGGTCTCAAGCAGCTGTCGCTTCTAAGCTTGATGCTTCTTTCTGCATCGGCAGCGAAGAATCCCAAAAGA
ACACTCGTGGGCATTGAAACGGCCGATAAGAGCCGTGGTATTGATGTGCCATTGAATGATTGCCATCCGATCGAG
GAAGAGGACGTTCTCACCGTGTCTTTGAAAAAGCCATGCCGTCTCTTCACCGGCCCTGACTGTACTGGGCACAAC
ACATTCTTGAGCCCTGGCGACCACTCTTCGAAGGACCCAATTCCTGTGATCGAGTCGATATTTTGCCAGTCATCA
TTTTGA
Transcript >Pro_DTO377G3_2|g8053.t1
ATGTACGGTCTCAAGCAGCTGTCGCTTCTAAGCTTGATGCTTCTTTCTGCATCGGCAGCGAAGAATCCCAAAAGA
ACACTCGTGGGCATTGAAACGGCCGATAAGAGCCGTGGTATTGATGTGCCATTGAATGATTGCCATCCGATCGAG
GAAGAGGACGTTCTCACCGTGTCTTTGAAAAAGCCATGCCGTCTCTTCACCGGCCCTGACTGTACTGGGCACAAC
ACATTCTTGAGCCCTGGCGACCACTCTTCGAAGGACCCAATTCCTGTGATCGAGTCGATATTTTGCCAGTCATCA
TTTTGA
Gene >Pro_DTO377G3_2|g8053.t1
ATGTACGGTCTCAAGCAGCTGTCGCTTCTAAGCTTGATGCTTCTTTCTGCATCGGCAGCGAAGAATCCCAAAAGA
ACACTCGTGCGTATGTTCTTCCTGAAGTCCACGCTCTGATGCTAACAGGACCATGCAGGTGGGCATTGAAACGGC
CGATAAGAGCCGTGGTATTGATGTGCCATTGAATGATTGCCATCCGATCGAGGAAGAGTGAGATAGATTTCCACC
TACCATGTTTCGGTTGAGAGAGACTAATGAGTCACAGGGACGTTCTCACCGTGTCTTTGAAAAAGCCATGCCGTC
TCTTCACGTAAGTCGGGTGCCGATCAAGAATTGGACTGTCACTAACTGTAGTACAGCGGCCCTGACTGTACTGGG
CACAACACATTCTTGAGCCCTGGCGACCACTCTTCGAAGGACCCAATTCCTGTGATCGAGTCGATATTTTGCCAG
TCATCATTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail