Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8050.t1
Gene name
Locationscaffold_28:224534..225853
Strand-
Gene length (bp)1319
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00355 Rieske Rieske [2Fe-2S] domain 1.2E-15 52 137
PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain) 2.4E-08 257 350

GO

GO Term Description Terminal node
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0044237 cellular metabolic process Yes
GO:0005506 iron ion binding Yes
GO:0046914 transition metal ion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0009987 cellular process No
GO:0051540 metal cluster binding No
GO:0051536 iron-sulfur cluster binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8050.t1
MSTLKNYFGLGGTDAHSTPTDNNSPAHPLPSSWYSSQDIHELERRAIFCRKWLLITHKLRFPKTGDWLRYDIAGY
AFILVKDREGNVNAFHNVCRHRAFPVVTEEGGTSRIFSCQYHGWSYGLNGKLAKAPGYQEVEGFDKSKNGLLPIH
VHIDVNGFIWVNLDASEKPEISWEDDFKGVDLQPRFTGFNFEDYDFDNTGEMSGEYNWKIMAEHYNECYRFSTTQ
SDTSVSNLDSYAVDAKSTAEEIANGLKIASTYYFPNATMTVSPHFFFMQRLVPTGPTTCSVRYDVYRNKKFSAEE
FEIISQVYKRIMSENQDRCVETQKNINMGKIQPAEEGPVNFQTVVRDLITQHHKREEDAGEQFWPARQRLPKGEA
VSKEDIDFCSKLSKDGSPLTSGGCCGGGCGAGPPSRAATAPETMVV*
Coding >Pro_DTO377G3_2|g8050.t1
ATGTCAACGCTCAAGAATTACTTCGGACTTGGGGGAACCGACGCCCATTCCACCCCTACCGACAACAATTCCCCG
GCTCACCCTCTCCCTTCCTCGTGGTATTCTTCGCAGGATATACATGAATTGGAGCGACGCGCCATATTCTGTCGG
AAATGGCTTCTGATCACGCACAAGTTGCGTTTCCCCAAAACAGGCGACTGGCTCCGATACGACATCGCCGGGTAC
GCTTTTATTTTGGTGAAAGACCGGGAGGGAAACGTCAATGCTTTCCACAATGTCTGTCGGCACCGTGCATTCCCA
GTGGTTACCGAAGAGGGTGGTACCTCCCGGATTTTCTCTTGTCAATATCACGGATGGTCCTACGGCCTTAATGGC
AAGCTTGCCAAGGCACCCGGATACCAAGAGGTGGAAGGTTTTGACAAGAGCAAGAACGGCCTTCTTCCTATCCAC
GTCCATATTGATGTCAACGGTTTTATCTGGGTCAATTTAGATGCCAGCGAAAAGCCCGAGATCTCGTGGGAAGAC
GACTTTAAAGGAGTCGACCTACAGCCACGTTTCACGGGTTTCAACTTCGAGGACTATGACTTTGATAACACCGGG
GAGATGAGTGGAGAGTACAATTGGAAGATTATGGCAGAGCACTACAACGAATGCTACCGTTTCTCAACGACTCAG
TCCGACACCTCGGTTTCCAATCTCGATTCATACGCCGTGGATGCCAAATCCACAGCCGAGGAGATTGCAAATGGG
CTGAAGATTGCCAGCACTTACTACTTCCCCAATGCTACTATGACCGTCTCGCCACACTTCTTCTTCATGCAGCGA
CTCGTGCCTACGGGCCCCACAACATGCTCAGTGCGCTATGACGTTTACCGCAACAAGAAATTTAGCGCCGAAGAG
TTTGAAATCATCAGCCAAGTGTACAAGCGCATTATGTCCGAAAACCAAGATCGCTGTGTCGAAACACAGAAGAAT
ATCAACATGGGTAAAATCCAGCCCGCGGAAGAGGGACCGGTCAACTTCCAGACTGTCGTTCGTGACCTGATCACA
CAGCACCATAAGCGGGAAGAAGATGCCGGGGAACAATTTTGGCCTGCACGACAAAGACTCCCCAAGGGAGAGGCA
GTCAGCAAAGAGGATATAGATTTCTGCTCTAAGCTGAGTAAGGATGGGTCACCTTTGACCTCGGGGGGTTGTTGT
GGAGGAGGATGTGGAGCTGGACCTCCATCTAGGGCAGCAACAGCGCCGGAGACTATGGTGGTTTAA
Transcript >Pro_DTO377G3_2|g8050.t1
ATGTCAACGCTCAAGAATTACTTCGGACTTGGGGGAACCGACGCCCATTCCACCCCTACCGACAACAATTCCCCG
GCTCACCCTCTCCCTTCCTCGTGGTATTCTTCGCAGGATATACATGAATTGGAGCGACGCGCCATATTCTGTCGG
AAATGGCTTCTGATCACGCACAAGTTGCGTTTCCCCAAAACAGGCGACTGGCTCCGATACGACATCGCCGGGTAC
GCTTTTATTTTGGTGAAAGACCGGGAGGGAAACGTCAATGCTTTCCACAATGTCTGTCGGCACCGTGCATTCCCA
GTGGTTACCGAAGAGGGTGGTACCTCCCGGATTTTCTCTTGTCAATATCACGGATGGTCCTACGGCCTTAATGGC
AAGCTTGCCAAGGCACCCGGATACCAAGAGGTGGAAGGTTTTGACAAGAGCAAGAACGGCCTTCTTCCTATCCAC
GTCCATATTGATGTCAACGGTTTTATCTGGGTCAATTTAGATGCCAGCGAAAAGCCCGAGATCTCGTGGGAAGAC
GACTTTAAAGGAGTCGACCTACAGCCACGTTTCACGGGTTTCAACTTCGAGGACTATGACTTTGATAACACCGGG
GAGATGAGTGGAGAGTACAATTGGAAGATTATGGCAGAGCACTACAACGAATGCTACCGTTTCTCAACGACTCAG
TCCGACACCTCGGTTTCCAATCTCGATTCATACGCCGTGGATGCCAAATCCACAGCCGAGGAGATTGCAAATGGG
CTGAAGATTGCCAGCACTTACTACTTCCCCAATGCTACTATGACCGTCTCGCCACACTTCTTCTTCATGCAGCGA
CTCGTGCCTACGGGCCCCACAACATGCTCAGTGCGCTATGACGTTTACCGCAACAAGAAATTTAGCGCCGAAGAG
TTTGAAATCATCAGCCAAGTGTACAAGCGCATTATGTCCGAAAACCAAGATCGCTGTGTCGAAACACAGAAGAAT
ATCAACATGGGTAAAATCCAGCCCGCGGAAGAGGGACCGGTCAACTTCCAGACTGTCGTTCGTGACCTGATCACA
CAGCACCATAAGCGGGAAGAAGATGCCGGGGAACAATTTTGGCCTGCACGACAAAGACTCCCCAAGGGAGAGGCA
GTCAGCAAAGAGGATATAGATTTCTGCTCTAAGCTGAGTAAGGATGGGTCACCTTTGACCTCGGGGGGTTGTTGT
GGAGGAGGATGTGGAGCTGGACCTCCATCTAGGGCAGCAACAGCGCCGGAGACTATGGTGGTTTAA
Gene >Pro_DTO377G3_2|g8050.t1
ATGTCAACGCTCAAGAATTACTTCGGACTTGGGGGAACCGACGCCCATTCCACCCCTACCGACAACAATTCCCCG
GCTCACCCTCTCCCTTCCTCGTGGTATTCTTCGCAGGATATACATGAATTGGAGCGACGCGCCATATTCTGTCGG
AAATGGCTTCTGATCACGCACAAGTTGCGTTTCCCCAAAACAGGCGACTGGCTCCGATACGACATCGCCGGGTAC
GCTTTTATTTTGGTGAAAGACCGGGAGGGAAACGTCAATGCTTTCCACAATGTCTGTCGGCACCGTGCATTCCCA
GTGGTTACCGAAGAGGGTGGTACCTCCCGGATTTTCTCTTGTCAATATCACGGATGGTCCTACGGCCTTAATGGC
AAGCTTGCCAAGGCACCCGGATACCAAGAGGTGGAAGGTTTTGACAAGAGCAAGAACGGCCTTCTTCCTATCCAC
GTCCATATTGATGTCAACGGTTTTATCTGGGTCAATTTAGATGCCAGCGAAAAGCCCGAGATCTCGTGGGAAGAC
GACTTTAAAGGAGTCGACCTACAGCCACGTTTCACGGGTTTCAACTTCGAGGACTATGACTTTGATAACACCGGG
GAGATGAGTGGAGAGTACAATTGGAAGATTATGGCAGAGCACTACAACGAATGCTACCGTTTCTCAACGACTCAG
TCCGACACCTCGGTTTCCAATCTCGATTCATACGCCGTGGATGCCAAATCCACAGCCGAGGAGATTGCAAATGGG
CTGAAGATTGCCAGCACTTACTACTTCCCCAATGCTACTATGACCGTCTCGTGAGTGTGATTGTCCGGCAATGTA
ATCCGATTGATGCTAATTTTGTACGCAGGCCACACTTCTTCTTCATGCAGCGACTCGTGCCTACGGGCCCCACAA
CATGCTCAGTGCGCTATGACGTTTACCGCAACAAGAAATTTAGCGCCGAAGAGTTTGAAATCATCAGCCAAGTGT
ACAAGCGCATTATGTCCGAAAACCAAGATCGCTGTGTCGAAACACAGAAGAATATCAACATGGGTAAAATCCAGC
CCGCGGAAGAGGGACCGGTCAACTTCCAGACTGTCGTTCGTGACCTGATCACACAGCACCATAAGCGGGAAGAAG
ATGCCGGGGAACAATTTTGGCCTGCACGACAAAGACTCCCCAAGGGAGAGGCAGTCAGCAAAGAGGATATAGATT
TCTGCTCTAAGCTGAGTAAGGATGGGTCACCTTTGACCTCGGGGGGTTGTTGTGGAGGAGGATGTGGAGCTGGAC
CTCCATCTAGGGCAGCAACAGCGCCGGAGACTATGGTGGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail