Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8043.t1
Gene name
Locationscaffold_28:196062..196689
Strand-
Gene length (bp)627
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00959 Phage_lysozyme Phage lysozyme 3.8E-16 49 163

GO

GO Term Description Terminal node
GO:0016998 cell wall macromolecule catabolic process Yes
GO:0009253 peptidoglycan catabolic process Yes
GO:0003796 lysozyme activity Yes
GO:0044036 cell wall macromolecule metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0009056 catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0000270 peptidoglycan metabolic process No
GO:0008150 biological_process No
GO:1901565 organonitrogen compound catabolic process No
GO:0003824 catalytic activity No
GO:0044265 cellular macromolecule catabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0016787 hydrolase activity No
GO:0006022 aminoglycan metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006027 glycosaminoglycan catabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0006026 aminoglycan catabolic process No
GO:0061783 peptidoglycan muralytic activity No
GO:0030203 glycosaminoglycan metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 10.28 2.46 18.09
5d_25C Five days - 25 degrees Celsius 9.79 2.04 17.55
7d_25C Seven days - 25 degrees Celsius 9.83 1.96 17.69
10d_25C Ten days - 25 degrees Celsius 13.08 3.52 22.63
7d_15C Seven days - 15 degrees Celsius 6.79 0.87 12.72
7d_30C Seven days - 30 degrees Celsius 15.14 4.14 26.14

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.943472 no
3d_25C 7d_25C 0.945963 no
3d_25C 7d_15C 0.413257 no
3d_25C 7d_30C 0.402670 no
3d_25C 10d_25C 0.641231 no
5d_25C 7d_25C 0.995455 no
5d_25C 7d_15C 0.505111 no
5d_25C 7d_30C 0.360842 no
5d_25C 10d_25C 0.580605 no
7d_25C 7d_15C 0.488223 no
7d_25C 7d_30C 0.345889 no
7d_25C 10d_25C 0.574117 no
7d_15C 7d_30C 0.075022 no
7d_15C 10d_25C 0.158075 no
7d_30C 10d_25C 0.798175 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8043.t1
MSFKLLLATLPALAFAACTGPAVNTNGLDLIKSFESFQANVYDDGYGNPTIGYGHLCSDSTCSEVTFSKPLTEDT
ASQLLAKDLVTYQNGVTNALATAVTLNDNQYAALVSWTFNVGVGNMQSSSLVSRMNAGENVETVASEELPKWNKA
NGAVVAGLTRRRADEVKLFEEASQTKALPVGC*
Coding >Pro_DTO377G3_2|g8043.t1
ATGTCGTTCAAGCTCCTGCTTGCCACCCTCCCAGCCCTGGCATTTGCTGCCTGCACCGGTCCTGCTGTCAACACC
AACGGCCTTGATCTAATCAAGAGCTTTGAATCCTTCCAAGCAAACGTGTACGATGATGGCTACGGCAATCCCACC
ATCGGCTACGGCCATCTCTGCAGCGACTCCACTTGCTCGGAAGTGACATTCTCCAAGCCATTGACCGAGGATACA
GCGAGCCAATTGCTTGCCAAAGACCTAGTGACCTACCAAAATGGCGTAACAAACGCCCTTGCCACCGCGGTTACT
CTGAACGACAACCAGTACGCGGCGCTCGTTTCGTGGACGTTCAACGTCGGCGTCGGGAACATGCAGTCATCCAGT
CTAGTCAGCCGCATGAATGCCGGTGAGAATGTGGAGACTGTGGCATCTGAGGAATTGCCCAAGTGGAATAAAGCC
AATGGGGCGGTTGTTGCTGGGCTGACGCGCCGGCGGGCTGATGAAGTGAAGCTGTTCGAGGAGGCTTCTCAGACC
AAGGCTTTGCCTGTTGGCTGTTAA
Transcript >Pro_DTO377G3_2|g8043.t1
ATGTCGTTCAAGCTCCTGCTTGCCACCCTCCCAGCCCTGGCATTTGCTGCCTGCACCGGTCCTGCTGTCAACACC
AACGGCCTTGATCTAATCAAGAGCTTTGAATCCTTCCAAGCAAACGTGTACGATGATGGCTACGGCAATCCCACC
ATCGGCTACGGCCATCTCTGCAGCGACTCCACTTGCTCGGAAGTGACATTCTCCAAGCCATTGACCGAGGATACA
GCGAGCCAATTGCTTGCCAAAGACCTAGTGACCTACCAAAATGGCGTAACAAACGCCCTTGCCACCGCGGTTACT
CTGAACGACAACCAGTACGCGGCGCTCGTTTCGTGGACGTTCAACGTCGGCGTCGGGAACATGCAGTCATCCAGT
CTAGTCAGCCGCATGAATGCCGGTGAGAATGTGGAGACTGTGGCATCTGAGGAATTGCCCAAGTGGAATAAAGCC
AATGGGGCGGTTGTTGCTGGGCTGACGCGCCGGCGGGCTGATGAAGTGAAGCTGTTCGAGGAGGCTTCTCAGACC
AAGGCTTTGCCTGTTGGCTGTTAA
Gene >Pro_DTO377G3_2|g8043.t1
ATGTCGTTCAAGCTCCTGCTTGCCACCCTCCCAGCCCTGGCATTTGCTGCCTGCACCGGTCCTGCTGTCAACACC
AACGGCCTTGATCTAATCAAGAGCTTTGAATCCTTCCAAGCAAACGTGTACGATGATGGCTACGGCAATCCCACC
ATCGGCTACGGCCATCTCTGCAGCGACTCCACTTGCTCGGAAGTGACATTCTCCAAGCCATTGACCGAGGATACA
GCGAGCCAATTGCTTGCCAAAGACCTAGTGGTAAGTCTCTACAAGCACTCTTCCTCCCTAAAACCCCACTATGTA
GGTATCTAATGAATGTACTAACCCGGAAAATAGACCTACCAAAATGGCGTAACAAACGCCCTTGCCACCGCGGTT
ACTCTGAACGACAACCAGTACGCGGCGCTCGTTTCGTGGACGTTCAACGTCGGCGTCGGGAACATGCAGTCATCC
AGTCTAGTCAGCCGCATGAATGCCGGTGAGAATGTGGAGACTGTGGCATCTGAGGAATTGCCCAAGTGGAATAAA
GCCAATGGGGCGGTTGTTGCTGGGCTGACGCGCCGGCGGGCTGATGAAGTGAAGCTGTTCGAGGAGGCTTCTCAG
ACCAAGGCTTTGCCTGTTGGCTGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail