Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8040.t1
Gene name
Locationscaffold_28:189437..191951
Strand+
Gene length (bp)2514
Transcript length (bp)2514
Coding sequence length (bp)2514
Protein length (aa) 838

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 9.1E-70 397 646
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 2.8E-12 676 822

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 505 523 18
2 530 548 18
3 592 614 22
4 627 649 22
5 669 688 19
6 695 712 17
7 716 738 22
8 750 772 22
9 804 826 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8040.t1
MSGIINPHPSPSEEYAEYPLPIIDNPGDRHSLEREATVDVNQYNAGIEPPTRRGSRSHHRVRFRSMSLRRNENDS
DPLSRPLLPQSDLNEIPLSGTITPPAPAHSRRGSNVHMPEFDETEKHDFTGKMDRATSARDRFRATGHLLRQKTS
RLTERLGRPTDEGEPLNASYNPDDFDSGIPLEELQARRARHEADRAHALESGENFIEPPPSAEAHRLVRSMTAVQ
DQLRKRKPRGAYQRSGQTTPEGLISAFTQRRRSSGVGGGILSQLLKLQVAQSGSSSRPESVITDDSDSDTQVSSS
ISTPKKGYISPLIPASQPASGAATPRKEKLKWYKKSAHRSTSSLVNASMNLSTASLPAAVEAAPGMQKKRGKSKR
KTRLEDEIRVTVHIAEIIARQRYIMQLCRALMRYGAPTHRLEEYMQMTARVLEVSGQFLYLPGCMIMSFDDPTTR
TAEVKLVRMVQGVDLGRLADTHNVYKNVVHDLIGVEEATQELDEIMQRKPRFSKWILVLVYGFASAAVGPFAFKA
RPIDMPIIFCLGCIVGLMQHVLAPRSTLYSNVFEVTAAILTSFLARAFGSIMVTRNGKSEPLFCFSAMAQSSIAL
ILPGFMVLCSSLELQSHQIIAGSIRMVYSIIYSLFLGYGITVGTTIYGLMDGNATSASTCSGLDVYGSVYARTFP
FVAVYAIFLAIVNHGKLKQMPVMVFIALSGYVANYFSTTKLGAQSEVANTVGAFTIGVLGNLYSRLWHGHAATAI
LPGIFVLVPSGLASSGSLIAGIKYADEVRQNLENNGTSSYSSSLSETSVASLGFGMIQVAIGITVGLFIAALVVY
PYGKKRTGLFSF*
Coding >Pro_DTO377G3_2|g8040.t1
ATGTCGGGCATCATCAACCCACACCCAAGCCCAAGTGAAGAATACGCAGAATACCCTCTCCCAATCATTGACAAT
CCCGGTGATCGTCATAGCCTCGAGCGTGAAGCCACCGTCGATGTCAACCAATACAATGCCGGGATCGAGCCACCC
ACACGCCGTGGGAGCCGATCCCATCATAGGGTTCGCTTTCGCTCGATGAGTCTTCGCCGAAACGAAAATGACTCC
GATCCCCTGTCACGACCGTTACTGCCGCAGTCAGATCTCAACGAAATCCCGCTATCCGGAACCATCACACCGCCA
GCCCCGGCCCATTCCCGGCGCGGCTCCAATGTGCATATGCCCGAGTTTGATGAAACCGAGAAACATGATTTCACA
GGTAAAATGGACCGGGCGACCTCGGCCCGCGACCGGTTCAGAGCGACCGGTCATCTGTTGCGACAGAAAACTAGC
CGCTTGACGGAACGCCTCGGTCGCCCCACGGATGAGGGCGAGCCGCTCAATGCCTCTTACAACCCAGACGACTTC
GACAGCGGTATTCCACTCGAGGAGCTGCAGGCCCGCCGCGCCCGCCATGAGGCCGACCGAGCGCACGCATTGGAG
AGTGGTGAGAATTTTATCGAGCCGCCCCCTAGCGCCGAGGCTCATCGCTTGGTGCGCAGCATGACCGCGGTTCAG
GATCAGCTACGGAAGCGCAAACCTCGGGGCGCATATCAGCGGTCGGGACAGACAACTCCCGAGGGCTTGATCAGC
GCCTTTACGCAGCGGAGACGGTCTAGTGGAGTCGGCGGCGGCATTCTGTCGCAGTTGCTCAAGCTTCAGGTCGCC
CAGAGCGGGAGCTCTTCGCGCCCGGAAAGTGTCATCACCGATGACTCCGACAGTGACACTCAGGTGTCTTCCAGT
ATCTCCACCCCGAAGAAGGGTTACATCTCGCCCCTTATCCCTGCGTCTCAGCCAGCCTCTGGTGCCGCCACCCCA
CGCAAGGAAAAGCTCAAATGGTACAAGAAGTCAGCCCATCGGTCCACCTCGTCGTTGGTCAATGCCTCCATGAAC
CTCAGCACGGCGAGCCTGCCTGCCGCGGTTGAGGCCGCTCCCGGTATGCAAAAGAAACGGGGGAAGAGCAAGCGC
AAGACCCGTCTAGAAGATGAGATCCGTGTTACCGTCCATATCGCAGAAATCATCGCACGTCAGCGGTATATCATG
CAGCTGTGCCGTGCGCTTATGCGATACGGTGCGCCGACCCATCGTCTGGAGGAGTATATGCAAATGACCGCCAGG
GTCCTGGAAGTTTCGGGCCAATTCTTATATCTGCCCGGTTGCATGATCATGTCCTTTGATGATCCTACTACACGC
ACGGCCGAAGTCAAGCTTGTACGGATGGTGCAAGGAGTCGACCTTGGTCGCCTTGCTGATACACACAACGTTTAC
AAGAATGTCGTTCACGATCTTATCGGCGTCGAAGAGGCAACTCAGGAACTAGACGAGATTATGCAGCGCAAGCCC
AGATTCAGTAAATGGATCTTGGTCCTGGTTTACGGTTTTGCTAGTGCAGCGGTCGGCCCGTTCGCTTTCAAAGCG
CGACCGATCGATATGCCCATCATCTTCTGTCTCGGTTGCATTGTTGGACTGATGCAGCACGTTCTCGCCCCACGG
TCAACTCTCTACTCCAACGTCTTTGAGGTTACTGCTGCTATTCTGACTTCCTTCCTCGCCCGCGCATTTGGCAGC
ATCATGGTTACCCGCAATGGTAAATCCGAACCACTTTTCTGCTTCTCCGCTATGGCACAGTCATCTATCGCTCTG
ATTCTCCCTGGATTCATGGTCCTTTGTAGCAGTCTGGAGCTGCAATCTCACCAGATCATCGCTGGTTCGATCCGT
ATGGTGTATTCCATTATCTACTCCCTCTTTTTGGGCTACGGTATTACAGTGGGGACTACGATCTACGGGCTAATG
GATGGCAATGCGACATCTGCATCTACGTGTTCAGGCCTGGATGTCTATGGGTCGGTTTATGCACGCACATTCCCC
TTCGTGGCTGTCTACGCTATTTTCCTAGCCATTGTGAACCATGGAAAATTAAAGCAGATGCCCGTCATGGTTTTC
ATCGCTTTGTCCGGGTACGTCGCCAACTATTTCAGCACGACCAAACTCGGCGCCCAATCGGAAGTCGCCAACACC
GTCGGTGCATTCACTATTGGTGTGCTAGGCAATCTGTACAGTCGGCTCTGGCATGGCCATGCCGCCACCGCCATT
CTTCCTGGTATATTTGTGCTGGTCCCCTCTGGCCTTGCTTCTAGTGGCTCTCTGATTGCGGGCATCAAATACGCC
GACGAGGTTCGTCAGAACCTTGAAAATAATGGGACTAGTTCATATTCCAGCTCTCTCTCTGAAACTTCAGTTGCC
AGTCTTGGTTTCGGCATGATCCAAGTCGCGATCGGTATCACAGTCGGGCTGTTTATCGCGGCTTTGGTTGTCTAC
CCCTACGGCAAAAAGCGCACCGGTCTGTTCAGCTTCTAG
Transcript >Pro_DTO377G3_2|g8040.t1
ATGTCGGGCATCATCAACCCACACCCAAGCCCAAGTGAAGAATACGCAGAATACCCTCTCCCAATCATTGACAAT
CCCGGTGATCGTCATAGCCTCGAGCGTGAAGCCACCGTCGATGTCAACCAATACAATGCCGGGATCGAGCCACCC
ACACGCCGTGGGAGCCGATCCCATCATAGGGTTCGCTTTCGCTCGATGAGTCTTCGCCGAAACGAAAATGACTCC
GATCCCCTGTCACGACCGTTACTGCCGCAGTCAGATCTCAACGAAATCCCGCTATCCGGAACCATCACACCGCCA
GCCCCGGCCCATTCCCGGCGCGGCTCCAATGTGCATATGCCCGAGTTTGATGAAACCGAGAAACATGATTTCACA
GGTAAAATGGACCGGGCGACCTCGGCCCGCGACCGGTTCAGAGCGACCGGTCATCTGTTGCGACAGAAAACTAGC
CGCTTGACGGAACGCCTCGGTCGCCCCACGGATGAGGGCGAGCCGCTCAATGCCTCTTACAACCCAGACGACTTC
GACAGCGGTATTCCACTCGAGGAGCTGCAGGCCCGCCGCGCCCGCCATGAGGCCGACCGAGCGCACGCATTGGAG
AGTGGTGAGAATTTTATCGAGCCGCCCCCTAGCGCCGAGGCTCATCGCTTGGTGCGCAGCATGACCGCGGTTCAG
GATCAGCTACGGAAGCGCAAACCTCGGGGCGCATATCAGCGGTCGGGACAGACAACTCCCGAGGGCTTGATCAGC
GCCTTTACGCAGCGGAGACGGTCTAGTGGAGTCGGCGGCGGCATTCTGTCGCAGTTGCTCAAGCTTCAGGTCGCC
CAGAGCGGGAGCTCTTCGCGCCCGGAAAGTGTCATCACCGATGACTCCGACAGTGACACTCAGGTGTCTTCCAGT
ATCTCCACCCCGAAGAAGGGTTACATCTCGCCCCTTATCCCTGCGTCTCAGCCAGCCTCTGGTGCCGCCACCCCA
CGCAAGGAAAAGCTCAAATGGTACAAGAAGTCAGCCCATCGGTCCACCTCGTCGTTGGTCAATGCCTCCATGAAC
CTCAGCACGGCGAGCCTGCCTGCCGCGGTTGAGGCCGCTCCCGGTATGCAAAAGAAACGGGGGAAGAGCAAGCGC
AAGACCCGTCTAGAAGATGAGATCCGTGTTACCGTCCATATCGCAGAAATCATCGCACGTCAGCGGTATATCATG
CAGCTGTGCCGTGCGCTTATGCGATACGGTGCGCCGACCCATCGTCTGGAGGAGTATATGCAAATGACCGCCAGG
GTCCTGGAAGTTTCGGGCCAATTCTTATATCTGCCCGGTTGCATGATCATGTCCTTTGATGATCCTACTACACGC
ACGGCCGAAGTCAAGCTTGTACGGATGGTGCAAGGAGTCGACCTTGGTCGCCTTGCTGATACACACAACGTTTAC
AAGAATGTCGTTCACGATCTTATCGGCGTCGAAGAGGCAACTCAGGAACTAGACGAGATTATGCAGCGCAAGCCC
AGATTCAGTAAATGGATCTTGGTCCTGGTTTACGGTTTTGCTAGTGCAGCGGTCGGCCCGTTCGCTTTCAAAGCG
CGACCGATCGATATGCCCATCATCTTCTGTCTCGGTTGCATTGTTGGACTGATGCAGCACGTTCTCGCCCCACGG
TCAACTCTCTACTCCAACGTCTTTGAGGTTACTGCTGCTATTCTGACTTCCTTCCTCGCCCGCGCATTTGGCAGC
ATCATGGTTACCCGCAATGGTAAATCCGAACCACTTTTCTGCTTCTCCGCTATGGCACAGTCATCTATCGCTCTG
ATTCTCCCTGGATTCATGGTCCTTTGTAGCAGTCTGGAGCTGCAATCTCACCAGATCATCGCTGGTTCGATCCGT
ATGGTGTATTCCATTATCTACTCCCTCTTTTTGGGCTACGGTATTACAGTGGGGACTACGATCTACGGGCTAATG
GATGGCAATGCGACATCTGCATCTACGTGTTCAGGCCTGGATGTCTATGGGTCGGTTTATGCACGCACATTCCCC
TTCGTGGCTGTCTACGCTATTTTCCTAGCCATTGTGAACCATGGAAAATTAAAGCAGATGCCCGTCATGGTTTTC
ATCGCTTTGTCCGGGTACGTCGCCAACTATTTCAGCACGACCAAACTCGGCGCCCAATCGGAAGTCGCCAACACC
GTCGGTGCATTCACTATTGGTGTGCTAGGCAATCTGTACAGTCGGCTCTGGCATGGCCATGCCGCCACCGCCATT
CTTCCTGGTATATTTGTGCTGGTCCCCTCTGGCCTTGCTTCTAGTGGCTCTCTGATTGCGGGCATCAAATACGCC
GACGAGGTTCGTCAGAACCTTGAAAATAATGGGACTAGTTCATATTCCAGCTCTCTCTCTGAAACTTCAGTTGCC
AGTCTTGGTTTCGGCATGATCCAAGTCGCGATCGGTATCACAGTCGGGCTGTTTATCGCGGCTTTGGTTGTCTAC
CCCTACGGCAAAAAGCGCACCGGTCTGTTCAGCTTCTAG
Gene >Pro_DTO377G3_2|g8040.t1
ATGTCGGGCATCATCAACCCACACCCAAGCCCAAGTGAAGAATACGCAGAATACCCTCTCCCAATCATTGACAAT
CCCGGTGATCGTCATAGCCTCGAGCGTGAAGCCACCGTCGATGTCAACCAATACAATGCCGGGATCGAGCCACCC
ACACGCCGTGGGAGCCGATCCCATCATAGGGTTCGCTTTCGCTCGATGAGTCTTCGCCGAAACGAAAATGACTCC
GATCCCCTGTCACGACCGTTACTGCCGCAGTCAGATCTCAACGAAATCCCGCTATCCGGAACCATCACACCGCCA
GCCCCGGCCCATTCCCGGCGCGGCTCCAATGTGCATATGCCCGAGTTTGATGAAACCGAGAAACATGATTTCACA
GGTAAAATGGACCGGGCGACCTCGGCCCGCGACCGGTTCAGAGCGACCGGTCATCTGTTGCGACAGAAAACTAGC
CGCTTGACGGAACGCCTCGGTCGCCCCACGGATGAGGGCGAGCCGCTCAATGCCTCTTACAACCCAGACGACTTC
GACAGCGGTATTCCACTCGAGGAGCTGCAGGCCCGCCGCGCCCGCCATGAGGCCGACCGAGCGCACGCATTGGAG
AGTGGTGAGAATTTTATCGAGCCGCCCCCTAGCGCCGAGGCTCATCGCTTGGTGCGCAGCATGACCGCGGTTCAG
GATCAGCTACGGAAGCGCAAACCTCGGGGCGCATATCAGCGGTCGGGACAGACAACTCCCGAGGGCTTGATCAGC
GCCTTTACGCAGCGGAGACGGTCTAGTGGAGTCGGCGGCGGCATTCTGTCGCAGTTGCTCAAGCTTCAGGTCGCC
CAGAGCGGGAGCTCTTCGCGCCCGGAAAGTGTCATCACCGATGACTCCGACAGTGACACTCAGGTGTCTTCCAGT
ATCTCCACCCCGAAGAAGGGTTACATCTCGCCCCTTATCCCTGCGTCTCAGCCAGCCTCTGGTGCCGCCACCCCA
CGCAAGGAAAAGCTCAAATGGTACAAGAAGTCAGCCCATCGGTCCACCTCGTCGTTGGTCAATGCCTCCATGAAC
CTCAGCACGGCGAGCCTGCCTGCCGCGGTTGAGGCCGCTCCCGGTATGCAAAAGAAACGGGGGAAGAGCAAGCGC
AAGACCCGTCTAGAAGATGAGATCCGTGTTACCGTCCATATCGCAGAAATCATCGCACGTCAGCGGTATATCATG
CAGCTGTGCCGTGCGCTTATGCGATACGGTGCGCCGACCCATCGTCTGGAGGAGTATATGCAAATGACCGCCAGG
GTCCTGGAAGTTTCGGGCCAATTCTTATATCTGCCCGGTTGCATGATCATGTCCTTTGATGATCCTACTACACGC
ACGGCCGAAGTCAAGCTTGTACGGATGGTGCAAGGAGTCGACCTTGGTCGCCTTGCTGATACACACAACGTTTAC
AAGAATGTCGTTCACGATCTTATCGGCGTCGAAGAGGCAACTCAGGAACTAGACGAGATTATGCAGCGCAAGCCC
AGATTCAGTAAATGGATCTTGGTCCTGGTTTACGGTTTTGCTAGTGCAGCGGTCGGCCCGTTCGCTTTCAAAGCG
CGACCGATCGATATGCCCATCATCTTCTGTCTCGGTTGCATTGTTGGACTGATGCAGCACGTTCTCGCCCCACGG
TCAACTCTCTACTCCAACGTCTTTGAGGTTACTGCTGCTATTCTGACTTCCTTCCTCGCCCGCGCATTTGGCAGC
ATCATGGTTACCCGCAATGGTAAATCCGAACCACTTTTCTGCTTCTCCGCTATGGCACAGTCATCTATCGCTCTG
ATTCTCCCTGGATTCATGGTCCTTTGTAGCAGTCTGGAGCTGCAATCTCACCAGATCATCGCTGGTTCGATCCGT
ATGGTGTATTCCATTATCTACTCCCTCTTTTTGGGCTACGGTATTACAGTGGGGACTACGATCTACGGGCTAATG
GATGGCAATGCGACATCTGCATCTACGTGTTCAGGCCTGGATGTCTATGGGTCGGTTTATGCACGCACATTCCCC
TTCGTGGCTGTCTACGCTATTTTCCTAGCCATTGTGAACCATGGAAAATTAAAGCAGATGCCCGTCATGGTTTTC
ATCGCTTTGTCCGGGTACGTCGCCAACTATTTCAGCACGACCAAACTCGGCGCCCAATCGGAAGTCGCCAACACC
GTCGGTGCATTCACTATTGGTGTGCTAGGCAATCTGTACAGTCGGCTCTGGCATGGCCATGCCGCCACCGCCATT
CTTCCTGGTATATTTGTGCTGGTCCCCTCTGGCCTTGCTTCTAGTGGCTCTCTGATTGCGGGCATCAAATACGCC
GACGAGGTTCGTCAGAACCTTGAAAATAATGGGACTAGTTCATATTCCAGCTCTCTCTCTGAAACTTCAGTTGCC
AGTCTTGGTTTCGGCATGATCCAAGTCGCGATCGGTATCACAGTCGGGCTGTTTATCGCGGCTTTGGTTGTCTAC
CCCTACGGCAAAAAGCGCACCGGTCTGTTCAGCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail