Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g804.t1
Gene name
Locationscaffold_01:2150893..2157752
Strand+
Gene length (bp)6859
Transcript length (bp)6735
Coding sequence length (bp)6735
Protein length (aa) 2245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 1.0E-83 591 794
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 6.9E-28 1127 1327
PF00117 GATase Glutamine amidotransferase class-I 5.7E-46 261 437
PF00988 CPSase_sm_chain Carbamoyl-phosphate synthase small chain, CPSase domain 2.6E-46 53 191
PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 4.5E-46 1943 2084
PF02787 CPSase_L_D3 Carbamoyl-phosphate synthetase large chain, oligomerisation domain 2.4E-37 880 1000
PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain 2.4E-29 2091 2240
PF02142 MGS MGS-like domain 1.4E-19 1407 1506
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 3.0E-06 616 761
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 3.4E-08 1140 1295
PF02222 ATP-grasp ATP-grasp domain 2.4E-04 606 741
PF02222 ATP-grasp ATP-grasp domain 1.6E-07 1136 1297

GO

GO Term Description Terminal node
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0016743 carboxyl- or carbamoyltransferase activity Yes
GO:0005524 ATP binding Yes
GO:0016597 amino acid binding Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043436 oxoacid metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0043177 organic acid binding No
GO:0009987 cellular process No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0019752 carboxylic acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044237 cellular metabolic process No
GO:0031406 carboxylic acid binding No
GO:0005488 binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0016874 ligase activity No
GO:0008152 metabolic process No
GO:0006082 organic acid metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016881 acid-amino acid ligase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g804.t1
MSPNSLEDPTLPTSPHLGSVVGYPEAQSNMDSVSGVIKPASIPIRGGSDRLVALELADGTVYQGYNFGAEKSASG
ELVFQTGMVGYPESITDPSYRGQILVITFPLVGNYGVPSHDEMCELLKDLPKHFESSQIHISALVVASYAGEDYS
HFLAKSSLGDWLKSEGIPAMHGVDTRALTKRLRETGSMLGRMLLQKSGSPPDVAATSGVDWKSHFEETEWVDPNT
KNLVAEVSIREPRLFTPPANVALKHPSGRGVRVLCLDVGMKYNQLRCLLARGVEVLVVPWDYDFPTLAGKDFDGL
FVSNGPGDPATLTVTIKNLTKMFEDARTPVFGICLGHQLIARAVGAQTTKMKFGNRGHNIPCTSMLSGKCHITSQ
NHGFAVDASSLHNGWEELFVNANDGSNEGIRHTSRPFFSVQFHPESTPGPRDTEYLFDVFINTIQSTIDSPEALN
MPVSFPGGTKADNLLAAPKVSVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGL
ADKVYFLPVNAEFVRKVIKHERPDAIYVTFGGQTALSVGIQLKDEFEELGVKVLGTPIDTIITTEDRELFARSMD
SINEKCAKSASASTLEESLRVVEDIGFPVIVRAAYALGGLGSGFAEDMDQLKELCTKALAVSPQVLIERSMKGWK
EIEYEVVRDAQDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNP
FSREYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLNEIKNSVTQSTCACFEPSLDYCVVKIPRWDLKK
FTRVSTQLGSSMKSVGEVMSIGRTFEEAIQKAIRSVDFHNVGFNESDALMSIKGELQTPSDQRLFAIANAMAAGY
TVDDIWKLTNIDKWFLSRLKGLSDFGKSMSTFNATTVPVPMIRQAKQLGFSDRQLANFLDSNELAVRRMRVEAGI
TPIVKQIDTVAAEFPAVTNYLYLTYNASQHDLTFDDHGIMVLGSGVYRIGSSVEFDWCSVRTIRTLREQGYKTIM
VNYNPETVSTDYDEADRLYFENINLETVLDIYQLETSSGVIMSMGGQTPNNIALPLHRLNVNILGTSPEMIDGAE
NRYKFSRMLDRIEVDQPAWKELTSIDEARDFCDKVGYPVLVRPSYVLSGAAMNTVYSEHDLASYLNQAVDVSREH
PVVITKYIENAKEIEMDAVARNGVMVGHFISEHVENAGVHSGDATLILPPQDLSPETVRRIEEATRKIGNALNVT
GPYNIQFIAKDNDIKVIECNVRASRSFPFVSKVMGVDLIEMATKAMMGIPFQEYPPVSIPKDYVGVKVPQFSFSR
LSGADPVLGVEMASTGEVASFGRDKYEAYLKALLSTGFRLPRRNILFSIGSYKEKLEMLPSIKKLHNLDYNLFAT
AGTADFLKENGVPVKYLEHLPDHEEEQMKSEYSLTQHLSNNLIDLYINLPSNNRFRRPANYMSKGYRTRRMAVDY
QTPLVTNVKNAKILIEAIARHFPLNIIPADYQTSHRTVVLPGLINIAAFVPNLVSVGSKDFEAVSKASISGGFSM
IRVMPVGVHSSVTSARDLKIVQQNALGKSLCDFNISVAATATNSDQIIQMTGEVGSLFVPFNHLSGNINKVATVT
NHFSSWPSSKPLITDAKSNDLASILLLASLHSRNIHVMSVTSKEDISLIALSKEKGLKVTCDVAIYCLFLSREDF
PTCSFLPTAEDQQALWDHMSTIDIFSIGSIPFQLAGKQATPESGIAEAIPLLFTAVAEGRLTIEDITARLYENPK
KIFELHDQADSSLEVEVDRPYVFQNPQAWSPFNGKTLRGSVQRVVFQGKTTCLDGEITKDAIKGTDMSTHRIVPT
SPVLKPVTPMVRPESSLDKHGSIGGTPGRRFRALSSAVGELGPPLYVASSQVSPSLADMLSRSAFRGKHILSVNQ
FSRADLHLLFTVAQEMRLGVQRHGVLDLLKGRVLTTLFYEPSTRTSASFDAAMQRLGGRTIAISTQHSSTQKGES
LQDTIRTLGCYGDAVVLRHPDSTSTEIAAKYSQVPVINGGNGALEHPTQAFLDLFTIREELGTVTGLTITFTGDL
KYGRPVHSLIKLLQFYDVRIQLVAPKALALPDDVRQQIVASGQLVLESEELTPEIVASSDILYSTRVQKERFVDI
LEYERLKNTFIIDNALLKHAKSHMVVMHPLPRNAEISEEVDFDQRAAYFRQMRYGLYCRMALLALVLAP*
Coding >Pro_DTO377G3_2|g804.t1
ATGTCTCCCAATTCCCTTGAGGATCCAACTCTGCCTACCAGCCCACACCTGGGTAGTGTAGTCGGATACCCAGAG
GCCCAGTCCAACATGGATTCCGTCAGTGGAGTGATCAAGCCGGCCTCCATCCCAATTCGGGGTGGCTCAGACCGG
TTGGTCGCCCTCGAACTCGCAGATGGTACTGTCTACCAAGGTTACAACTTTGGTGCTGAAAAGAGTGCCTCGGGT
GAATTGGTCTTCCAGACTGGTATGGTCGGTTATCCCGAGTCTATCACCGACCCTTCATACCGTGGCCAGATCCTG
GTCATCACTTTCCCGCTCGTGGGTAACTACGGTGTCCCTTCGCACGATGAGATGTGTGAGCTCCTGAAGGACTTG
CCCAAGCACTTCGAGTCCAGTCAGATTCACATTTCGGCCTTGGTGGTGGCATCCTACGCCGGTGAGGATTACTCG
CACTTCTTGGCCAAGTCCTCCCTGGGCGATTGGCTCAAGTCCGAGGGCATTCCGGCTATGCACGGTGTCGACACT
CGTGCTTTGACTAAGCGCCTTCGTGAGACCGGTAGCATGCTGGGTCGCATGTTGCTGCAAAAGTCTGGCTCCCCT
CCTGATGTTGCTGCTACTAGCGGTGTCGACTGGAAGTCACACTTCGAGGAGACTGAATGGGTGGATCCCAACACA
AAGAACCTCGTCGCTGAGGTCTCGATTCGCGAACCTCGCCTATTCACACCCCCCGCCAATGTCGCCCTCAAACAC
CCCTCGGGCCGTGGAGTCCGCGTCCTTTGCTTGGATGTCGGTATGAAGTACAACCAGCTGCGTTGTTTGCTTGCC
CGCGGTGTCGAGGTTCTGGTTGTGCCATGGGACTATGATTTCCCCACCCTTGCTGGAAAGGACTTCGACGGTCTC
TTCGTGTCCAACGGTCCTGGTGATCCCGCGACCCTTACTGTTACCATTAAGAACCTGACCAAGATGTTCGAGGAT
GCTCGTACTCCCGTCTTCGGTATCTGTCTGGGTCACCAGTTGATTGCTCGTGCTGTCGGCGCTCAGACTACCAAG
ATGAAGTTCGGTAACCGTGGTCACAACATCCCCTGCACAAGCATGCTCTCTGGCAAGTGCCACATTACTTCCCAG
AACCATGGTTTTGCTGTGGATGCCAGCAGCCTTCATAACGGATGGGAAGAGCTGTTCGTCAACGCCAATGACGGC
AGCAACGAGGGTATTCGTCACACCAGCCGTCCCTTCTTCAGTGTTCAATTCCATCCCGAGAGCACACCCGGCCCC
CGGGATACCGAGTACCTGTTTGATGTGTTCATCAACACCATCCAGTCTACCATTGACTCCCCCGAGGCTCTCAAC
ATGCCTGTCTCCTTCCCCGGTGGCACCAAGGCCGATAATCTCCTGGCCGCCCCCAAAGTCTCGGTCAAGAAGGTT
CTGGTTCTTGGCTCCGGTGGTCTTAGCATTGGTCAGGCTGGAGAGTTCGATTACTCTGGCAGTCAAGCCATCAAG
GCCTTGAAGGAAGAGGGTATCTACACCATTTTGATCAACCCCAATATTGCCACCATTCAGACCTCCAAGGGTCTG
GCTGACAAGGTTTACTTCCTGCCCGTCAACGCCGAGTTCGTCCGCAAGGTGATCAAGCACGAGCGTCCTGATGCC
ATCTACGTCACTTTCGGTGGCCAGACTGCCCTTTCCGTGGGTATCCAGCTTAAGGACGAGTTCGAAGAACTCGGC
GTCAAGGTCCTCGGTACCCCTATTGATACTATCATCACTACTGAGGATCGTGAGCTGTTTGCTCGCAGCATGGAT
TCCATCAACGAGAAGTGCGCCAAGTCTGCCTCTGCTTCCACCCTCGAGGAGTCCCTGCGTGTGGTTGAGGACATT
GGTTTCCCCGTCATTGTTCGTGCCGCCTACGCTCTTGGTGGACTTGGCAGTGGTTTCGCGGAGGACATGGATCAG
CTGAAGGAGCTCTGCACTAAGGCTTTGGCCGTCAGCCCCCAGGTGCTGATTGAGCGCAGTATGAAGGGCTGGAAG
GAGATTGAATACGAGGTTGTTCGTGATGCCCAGGACAACTGCATCACTGTCTGCAACATGGAGAACTTCGATCCC
CTTGGTATTCACACTGGTGACTCCATTGTCGTTGCTCCTTCCCAGACCCTCTCAGACGAAGACTACAACATGCTA
CGAACCACCGCAGTCAACGTCATTCGTCACCTCGGTGTTGTCGGTGAATGTAACATTCAGTATGCCCTCAACCCC
TTCTCGAGGGAGTACTGTATCATTGAAGTCAACGCTCGTCTGTCTCGGTCCTCCGCCCTGGCCTCTAAGGCTACC
GGATACCCTCTTGCTTTCATTGCTGCCAAGTTGGGTCTTGGTATCCCCCTGAATGAGATTAAGAATTCGGTCACC
CAGTCCACTTGCGCCTGCTTCGAGCCATCGCTCGACTACTGCGTGGTTAAGATTCCTCGTTGGGATCTGAAGAAG
TTTACCCGTGTGTCTACTCAGCTTGGTTCTTCCATGAAGAGTGTCGGTGAAGTTATGAGCATTGGCCGAACCTTC
GAGGAAGCTATTCAGAAGGCTATTCGCTCGGTTGATTTCCACAACGTTGGTTTCAATGAGTCCGATGCCCTCATG
TCCATCAAGGGCGAGCTCCAGACTCCCTCCGACCAGCGTCTGTTTGCCATTGCCAATGCCATGGCCGCCGGTTAC
ACTGTTGATGACATCTGGAAACTCACCAACATTGACAAGTGGTTCCTCAGCCGACTCAAGGGCCTCAGCGACTTC
GGCAAGTCCATGTCCACCTTCAATGCTACCACTGTGCCTGTGCCTATGATCCGACAGGCCAAGCAGCTTGGTTTC
TCCGATCGTCAGCTCGCCAACTTCTTGGACTCCAACGAGCTTGCTGTGCGCCGCATGCGTGTTGAGGCTGGTATC
ACACCTATCGTCAAGCAGATTGATACTGTTGCCGCCGAATTCCCAGCCGTGACCAACTACCTATACCTCACCTAT
AATGCTTCTCAGCATGACCTGACGTTCGACGATCACGGTATCATGGTTCTGGGTTCTGGTGTCTACCGTATCGGT
TCCTCTGTCGAATTCGATTGGTGTTCCGTGCGTACCATTCGTACGCTCCGCGAGCAGGGCTACAAGACTATCATG
GTCAACTACAACCCGGAGACCGTTAGTACCGATTACGATGAGGCCGACCGCCTTTACTTCGAGAACATCAACCTG
GAGACTGTTCTGGACATTTACCAGCTGGAGACTTCCAGCGGTGTGATCATGTCCATGGGTGGTCAGACCCCGAAC
AACATCGCTCTGCCTCTTCACCGCCTCAATGTCAACATCCTGGGTACTTCCCCCGAGATGATTGATGGTGCTGAG
AACCGTTACAAGTTCTCCCGCATGTTGGATCGTATCGAAGTTGATCAGCCCGCTTGGAAGGAGCTGACTAGCATT
GACGAGGCCCGCGATTTCTGTGACAAGGTCGGCTACCCCGTGCTGGTCCGTCCTTCATACGTGCTCTCTGGTGCT
GCCATGAACACTGTGTATTCCGAGCACGATCTGGCCAGCTATTTGAACCAGGCTGTCGATGTTTCGCGTGAGCAC
CCTGTGGTTATCACTAAGTATATCGAAAACGCCAAGGAGATTGAGATGGACGCTGTTGCCCGTAACGGTGTTATG
GTTGGCCACTTCATCTCCGAGCACGTTGAAAATGCTGGTGTTCACTCTGGTGACGCTACTCTGATCCTACCTCCC
CAGGATTTGAGCCCGGAGACCGTGCGTCGCATTGAGGAGGCTACCCGGAAGATCGGTAATGCTCTGAACGTTACT
GGCCCTTACAACATTCAGTTCATTGCCAAGGATAATGACATCAAGGTCATTGAGTGTAACGTTCGTGCCTCGCGA
TCGTTCCCCTTCGTGTCCAAGGTCATGGGTGTTGACCTCATCGAGATGGCCACCAAGGCCATGATGGGAATTCCA
TTCCAGGAGTACCCCCCTGTGTCAATTCCTAAGGACTACGTCGGTGTTAAGGTCCCCCAGTTCTCGTTCTCACGT
CTGTCCGGTGCCGACCCCGTCCTGGGTGTCGAGATGGCCTCTACTGGTGAGGTTGCCTCGTTCGGTCGTGACAAG
TACGAGGCCTACCTGAAGGCTCTGTTGTCCACTGGATTCCGTCTTCCCCGCCGCAACATTCTGTTCTCCATTGGT
TCCTACAAGGAGAAGCTTGAGATGCTACCCTCGATCAAGAAGCTCCACAATCTTGATTACAACCTGTTCGCCACT
GCTGGTACCGCTGATTTCCTTAAGGAGAACGGCGTGCCTGTCAAGTACCTTGAGCATCTTCCGGACCACGAGGAG
GAGCAGATGAAGTCTGAGTACTCTCTCACCCAGCACTTGTCCAACAACCTCATCGATCTGTACATCAACTTGCCG
TCCAACAACCGCTTCCGCCGCCCTGCCAACTACATGTCCAAGGGTTACCGTACTCGTCGTATGGCTGTTGACTAC
CAGACTCCTCTGGTCACCAACGTGAAGAATGCGAAGATCTTGATCGAGGCTATTGCTCGCCACTTCCCTCTGAAC
ATCATCCCCGCCGACTACCAGACTAGCCACCGCACTGTGGTCCTCCCCGGTTTGATCAATATTGCTGCGTTCGTC
CCGAACCTTGTCTCCGTTGGTTCCAAGGACTTCGAAGCTGTTTCCAAGGCTTCGATTTCAGGTGGTTTCAGCATG
ATCCGTGTGATGCCTGTCGGTGTTCACAGCTCGGTCACATCGGCCCGCGACCTCAAGATTGTCCAGCAGAACGCT
CTGGGCAAGTCGCTCTGCGACTTCAACATCTCTGTTGCTGCCACTGCCACCAACTCAGACCAGATCATCCAGATG
ACTGGTGAGGTTGGCTCTCTCTTCGTACCCTTCAACCACTTGTCGGGTAACATCAACAAGGTGGCCACTGTCACC
AACCACTTCAGCTCCTGGCCCTCAAGCAAACCCCTGATCACGGATGCCAAGAGCAATGATCTCGCCTCGATTCTG
TTGTTGGCCAGCCTCCACAGCCGTAACATTCACGTCATGAGTGTTACCTCCAAGGAGGATATCAGCCTTATTGCT
CTGAGCAAGGAGAAGGGCCTGAAGGTGACCTGCGATGTTGCTATCTACTGCCTTTTCCTTTCCCGCGAGGATTTC
CCGACCTGCAGCTTCCTGCCCACCGCCGAGGACCAGCAGGCTCTATGGGACCATATGAGCACCATCGATATCTTC
TCTATTGGCAGCATTCCCTTCCAGCTTGCTGGCAAGCAGGCTACTCCCGAGTCCGGCATCGCTGAGGCTATTCCT
CTGCTGTTCACCGCTGTCGCCGAGGGCCGCCTGACCATTGAGGACATCACCGCTCGTCTCTATGAGAACCCCAAG
AAGATCTTCGAGCTGCACGACCAGGCCGATAGCTCGCTCGAGGTCGAGGTTGACCGCCCCTACGTTTTCCAGAAT
CCCCAAGCCTGGTCTCCGTTCAACGGCAAGACGTTGCGTGGCTCCGTTCAGCGTGTTGTTTTCCAGGGCAAGACC
ACCTGCCTCGATGGCGAGATCACCAAGGATGCCATCAAGGGTACCGACATGTCCACTCACCGTATCGTCCCTACC
TCGCCTGTGCTGAAGCCCGTGACCCCCATGGTTCGCCCGGAGAGTTCCCTTGACAAACACGGGTCTATCGGTGGT
ACTCCTGGCCGCCGCTTCCGGGCCCTGTCCAGCGCTGTCGGCGAACTTGGTCCTCCTCTTTACGTCGCCTCCTCG
CAGGTCTCACCCTCGCTGGCTGATATGCTCTCCCGATCTGCTTTCCGGGGAAAGCACATCCTGTCTGTGAACCAG
TTCTCTCGCGCCGACTTGCACCTGCTGTTCACCGTCGCTCAGGAGATGCGTCTTGGAGTCCAGCGCCACGGTGTT
CTTGACCTCCTGAAGGGCCGTGTTTTGACCACCCTCTTCTACGAGCCCTCCACGCGCACCTCGGCCTCTTTCGAC
GCCGCCATGCAGCGCCTCGGTGGACGTACCATTGCCATCTCCACTCAGCACTCTTCTACCCAGAAGGGTGAGTCT
CTCCAGGACACCATCCGCACTCTCGGCTGCTACGGTGACGCTGTTGTTCTGCGCCACCCCGACTCGACCAGCACC
GAGATCGCGGCCAAATACTCCCAGGTCCCCGTCATCAACGGTGGCAACGGTGCCCTTGAGCACCCCACCCAGGCC
TTCTTAGACTTGTTCACCATCCGCGAGGAGTTGGGCACTGTCACCGGGTTGACCATCACCTTCACTGGTGATCTC
AAGTACGGCCGCCCCGTGCACTCCCTCATCAAGCTGCTCCAGTTCTACGATGTCCGCATCCAGCTTGTTGCCCCC
AAGGCTCTCGCTCTCCCCGACGATGTCCGCCAGCAGATCGTTGCTTCCGGCCAGTTGGTCCTCGAGTCTGAGGAG
CTCACTCCTGAGATTGTCGCCAGCTCCGACATACTGTACTCCACTCGTGTGCAGAAGGAGCGCTTCGTCGACATT
CTTGAGTACGAGCGTCTCAAGAACACCTTTATCATCGACAACGCTCTGCTCAAGCACGCCAAGAGCCACATGGTT
GTCATGCATCCCCTCCCTCGCAATGCCGAGATCTCTGAGGAAGTCGACTTCGACCAGCGGGCTGCTTACTTCCGC
CAGATGCGCTACGGCCTCTACTGCCGCATGGCTCTCCTTGCTCTCGTCTTGGCGCCATGA
Transcript >Pro_DTO377G3_2|g804.t1
ATGTCTCCCAATTCCCTTGAGGATCCAACTCTGCCTACCAGCCCACACCTGGGTAGTGTAGTCGGATACCCAGAG
GCCCAGTCCAACATGGATTCCGTCAGTGGAGTGATCAAGCCGGCCTCCATCCCAATTCGGGGTGGCTCAGACCGG
TTGGTCGCCCTCGAACTCGCAGATGGTACTGTCTACCAAGGTTACAACTTTGGTGCTGAAAAGAGTGCCTCGGGT
GAATTGGTCTTCCAGACTGGTATGGTCGGTTATCCCGAGTCTATCACCGACCCTTCATACCGTGGCCAGATCCTG
GTCATCACTTTCCCGCTCGTGGGTAACTACGGTGTCCCTTCGCACGATGAGATGTGTGAGCTCCTGAAGGACTTG
CCCAAGCACTTCGAGTCCAGTCAGATTCACATTTCGGCCTTGGTGGTGGCATCCTACGCCGGTGAGGATTACTCG
CACTTCTTGGCCAAGTCCTCCCTGGGCGATTGGCTCAAGTCCGAGGGCATTCCGGCTATGCACGGTGTCGACACT
CGTGCTTTGACTAAGCGCCTTCGTGAGACCGGTAGCATGCTGGGTCGCATGTTGCTGCAAAAGTCTGGCTCCCCT
CCTGATGTTGCTGCTACTAGCGGTGTCGACTGGAAGTCACACTTCGAGGAGACTGAATGGGTGGATCCCAACACA
AAGAACCTCGTCGCTGAGGTCTCGATTCGCGAACCTCGCCTATTCACACCCCCCGCCAATGTCGCCCTCAAACAC
CCCTCGGGCCGTGGAGTCCGCGTCCTTTGCTTGGATGTCGGTATGAAGTACAACCAGCTGCGTTGTTTGCTTGCC
CGCGGTGTCGAGGTTCTGGTTGTGCCATGGGACTATGATTTCCCCACCCTTGCTGGAAAGGACTTCGACGGTCTC
TTCGTGTCCAACGGTCCTGGTGATCCCGCGACCCTTACTGTTACCATTAAGAACCTGACCAAGATGTTCGAGGAT
GCTCGTACTCCCGTCTTCGGTATCTGTCTGGGTCACCAGTTGATTGCTCGTGCTGTCGGCGCTCAGACTACCAAG
ATGAAGTTCGGTAACCGTGGTCACAACATCCCCTGCACAAGCATGCTCTCTGGCAAGTGCCACATTACTTCCCAG
AACCATGGTTTTGCTGTGGATGCCAGCAGCCTTCATAACGGATGGGAAGAGCTGTTCGTCAACGCCAATGACGGC
AGCAACGAGGGTATTCGTCACACCAGCCGTCCCTTCTTCAGTGTTCAATTCCATCCCGAGAGCACACCCGGCCCC
CGGGATACCGAGTACCTGTTTGATGTGTTCATCAACACCATCCAGTCTACCATTGACTCCCCCGAGGCTCTCAAC
ATGCCTGTCTCCTTCCCCGGTGGCACCAAGGCCGATAATCTCCTGGCCGCCCCCAAAGTCTCGGTCAAGAAGGTT
CTGGTTCTTGGCTCCGGTGGTCTTAGCATTGGTCAGGCTGGAGAGTTCGATTACTCTGGCAGTCAAGCCATCAAG
GCCTTGAAGGAAGAGGGTATCTACACCATTTTGATCAACCCCAATATTGCCACCATTCAGACCTCCAAGGGTCTG
GCTGACAAGGTTTACTTCCTGCCCGTCAACGCCGAGTTCGTCCGCAAGGTGATCAAGCACGAGCGTCCTGATGCC
ATCTACGTCACTTTCGGTGGCCAGACTGCCCTTTCCGTGGGTATCCAGCTTAAGGACGAGTTCGAAGAACTCGGC
GTCAAGGTCCTCGGTACCCCTATTGATACTATCATCACTACTGAGGATCGTGAGCTGTTTGCTCGCAGCATGGAT
TCCATCAACGAGAAGTGCGCCAAGTCTGCCTCTGCTTCCACCCTCGAGGAGTCCCTGCGTGTGGTTGAGGACATT
GGTTTCCCCGTCATTGTTCGTGCCGCCTACGCTCTTGGTGGACTTGGCAGTGGTTTCGCGGAGGACATGGATCAG
CTGAAGGAGCTCTGCACTAAGGCTTTGGCCGTCAGCCCCCAGGTGCTGATTGAGCGCAGTATGAAGGGCTGGAAG
GAGATTGAATACGAGGTTGTTCGTGATGCCCAGGACAACTGCATCACTGTCTGCAACATGGAGAACTTCGATCCC
CTTGGTATTCACACTGGTGACTCCATTGTCGTTGCTCCTTCCCAGACCCTCTCAGACGAAGACTACAACATGCTA
CGAACCACCGCAGTCAACGTCATTCGTCACCTCGGTGTTGTCGGTGAATGTAACATTCAGTATGCCCTCAACCCC
TTCTCGAGGGAGTACTGTATCATTGAAGTCAACGCTCGTCTGTCTCGGTCCTCCGCCCTGGCCTCTAAGGCTACC
GGATACCCTCTTGCTTTCATTGCTGCCAAGTTGGGTCTTGGTATCCCCCTGAATGAGATTAAGAATTCGGTCACC
CAGTCCACTTGCGCCTGCTTCGAGCCATCGCTCGACTACTGCGTGGTTAAGATTCCTCGTTGGGATCTGAAGAAG
TTTACCCGTGTGTCTACTCAGCTTGGTTCTTCCATGAAGAGTGTCGGTGAAGTTATGAGCATTGGCCGAACCTTC
GAGGAAGCTATTCAGAAGGCTATTCGCTCGGTTGATTTCCACAACGTTGGTTTCAATGAGTCCGATGCCCTCATG
TCCATCAAGGGCGAGCTCCAGACTCCCTCCGACCAGCGTCTGTTTGCCATTGCCAATGCCATGGCCGCCGGTTAC
ACTGTTGATGACATCTGGAAACTCACCAACATTGACAAGTGGTTCCTCAGCCGACTCAAGGGCCTCAGCGACTTC
GGCAAGTCCATGTCCACCTTCAATGCTACCACTGTGCCTGTGCCTATGATCCGACAGGCCAAGCAGCTTGGTTTC
TCCGATCGTCAGCTCGCCAACTTCTTGGACTCCAACGAGCTTGCTGTGCGCCGCATGCGTGTTGAGGCTGGTATC
ACACCTATCGTCAAGCAGATTGATACTGTTGCCGCCGAATTCCCAGCCGTGACCAACTACCTATACCTCACCTAT
AATGCTTCTCAGCATGACCTGACGTTCGACGATCACGGTATCATGGTTCTGGGTTCTGGTGTCTACCGTATCGGT
TCCTCTGTCGAATTCGATTGGTGTTCCGTGCGTACCATTCGTACGCTCCGCGAGCAGGGCTACAAGACTATCATG
GTCAACTACAACCCGGAGACCGTTAGTACCGATTACGATGAGGCCGACCGCCTTTACTTCGAGAACATCAACCTG
GAGACTGTTCTGGACATTTACCAGCTGGAGACTTCCAGCGGTGTGATCATGTCCATGGGTGGTCAGACCCCGAAC
AACATCGCTCTGCCTCTTCACCGCCTCAATGTCAACATCCTGGGTACTTCCCCCGAGATGATTGATGGTGCTGAG
AACCGTTACAAGTTCTCCCGCATGTTGGATCGTATCGAAGTTGATCAGCCCGCTTGGAAGGAGCTGACTAGCATT
GACGAGGCCCGCGATTTCTGTGACAAGGTCGGCTACCCCGTGCTGGTCCGTCCTTCATACGTGCTCTCTGGTGCT
GCCATGAACACTGTGTATTCCGAGCACGATCTGGCCAGCTATTTGAACCAGGCTGTCGATGTTTCGCGTGAGCAC
CCTGTGGTTATCACTAAGTATATCGAAAACGCCAAGGAGATTGAGATGGACGCTGTTGCCCGTAACGGTGTTATG
GTTGGCCACTTCATCTCCGAGCACGTTGAAAATGCTGGTGTTCACTCTGGTGACGCTACTCTGATCCTACCTCCC
CAGGATTTGAGCCCGGAGACCGTGCGTCGCATTGAGGAGGCTACCCGGAAGATCGGTAATGCTCTGAACGTTACT
GGCCCTTACAACATTCAGTTCATTGCCAAGGATAATGACATCAAGGTCATTGAGTGTAACGTTCGTGCCTCGCGA
TCGTTCCCCTTCGTGTCCAAGGTCATGGGTGTTGACCTCATCGAGATGGCCACCAAGGCCATGATGGGAATTCCA
TTCCAGGAGTACCCCCCTGTGTCAATTCCTAAGGACTACGTCGGTGTTAAGGTCCCCCAGTTCTCGTTCTCACGT
CTGTCCGGTGCCGACCCCGTCCTGGGTGTCGAGATGGCCTCTACTGGTGAGGTTGCCTCGTTCGGTCGTGACAAG
TACGAGGCCTACCTGAAGGCTCTGTTGTCCACTGGATTCCGTCTTCCCCGCCGCAACATTCTGTTCTCCATTGGT
TCCTACAAGGAGAAGCTTGAGATGCTACCCTCGATCAAGAAGCTCCACAATCTTGATTACAACCTGTTCGCCACT
GCTGGTACCGCTGATTTCCTTAAGGAGAACGGCGTGCCTGTCAAGTACCTTGAGCATCTTCCGGACCACGAGGAG
GAGCAGATGAAGTCTGAGTACTCTCTCACCCAGCACTTGTCCAACAACCTCATCGATCTGTACATCAACTTGCCG
TCCAACAACCGCTTCCGCCGCCCTGCCAACTACATGTCCAAGGGTTACCGTACTCGTCGTATGGCTGTTGACTAC
CAGACTCCTCTGGTCACCAACGTGAAGAATGCGAAGATCTTGATCGAGGCTATTGCTCGCCACTTCCCTCTGAAC
ATCATCCCCGCCGACTACCAGACTAGCCACCGCACTGTGGTCCTCCCCGGTTTGATCAATATTGCTGCGTTCGTC
CCGAACCTTGTCTCCGTTGGTTCCAAGGACTTCGAAGCTGTTTCCAAGGCTTCGATTTCAGGTGGTTTCAGCATG
ATCCGTGTGATGCCTGTCGGTGTTCACAGCTCGGTCACATCGGCCCGCGACCTCAAGATTGTCCAGCAGAACGCT
CTGGGCAAGTCGCTCTGCGACTTCAACATCTCTGTTGCTGCCACTGCCACCAACTCAGACCAGATCATCCAGATG
ACTGGTGAGGTTGGCTCTCTCTTCGTACCCTTCAACCACTTGTCGGGTAACATCAACAAGGTGGCCACTGTCACC
AACCACTTCAGCTCCTGGCCCTCAAGCAAACCCCTGATCACGGATGCCAAGAGCAATGATCTCGCCTCGATTCTG
TTGTTGGCCAGCCTCCACAGCCGTAACATTCACGTCATGAGTGTTACCTCCAAGGAGGATATCAGCCTTATTGCT
CTGAGCAAGGAGAAGGGCCTGAAGGTGACCTGCGATGTTGCTATCTACTGCCTTTTCCTTTCCCGCGAGGATTTC
CCGACCTGCAGCTTCCTGCCCACCGCCGAGGACCAGCAGGCTCTATGGGACCATATGAGCACCATCGATATCTTC
TCTATTGGCAGCATTCCCTTCCAGCTTGCTGGCAAGCAGGCTACTCCCGAGTCCGGCATCGCTGAGGCTATTCCT
CTGCTGTTCACCGCTGTCGCCGAGGGCCGCCTGACCATTGAGGACATCACCGCTCGTCTCTATGAGAACCCCAAG
AAGATCTTCGAGCTGCACGACCAGGCCGATAGCTCGCTCGAGGTCGAGGTTGACCGCCCCTACGTTTTCCAGAAT
CCCCAAGCCTGGTCTCCGTTCAACGGCAAGACGTTGCGTGGCTCCGTTCAGCGTGTTGTTTTCCAGGGCAAGACC
ACCTGCCTCGATGGCGAGATCACCAAGGATGCCATCAAGGGTACCGACATGTCCACTCACCGTATCGTCCCTACC
TCGCCTGTGCTGAAGCCCGTGACCCCCATGGTTCGCCCGGAGAGTTCCCTTGACAAACACGGGTCTATCGGTGGT
ACTCCTGGCCGCCGCTTCCGGGCCCTGTCCAGCGCTGTCGGCGAACTTGGTCCTCCTCTTTACGTCGCCTCCTCG
CAGGTCTCACCCTCGCTGGCTGATATGCTCTCCCGATCTGCTTTCCGGGGAAAGCACATCCTGTCTGTGAACCAG
TTCTCTCGCGCCGACTTGCACCTGCTGTTCACCGTCGCTCAGGAGATGCGTCTTGGAGTCCAGCGCCACGGTGTT
CTTGACCTCCTGAAGGGCCGTGTTTTGACCACCCTCTTCTACGAGCCCTCCACGCGCACCTCGGCCTCTTTCGAC
GCCGCCATGCAGCGCCTCGGTGGACGTACCATTGCCATCTCCACTCAGCACTCTTCTACCCAGAAGGGTGAGTCT
CTCCAGGACACCATCCGCACTCTCGGCTGCTACGGTGACGCTGTTGTTCTGCGCCACCCCGACTCGACCAGCACC
GAGATCGCGGCCAAATACTCCCAGGTCCCCGTCATCAACGGTGGCAACGGTGCCCTTGAGCACCCCACCCAGGCC
TTCTTAGACTTGTTCACCATCCGCGAGGAGTTGGGCACTGTCACCGGGTTGACCATCACCTTCACTGGTGATCTC
AAGTACGGCCGCCCCGTGCACTCCCTCATCAAGCTGCTCCAGTTCTACGATGTCCGCATCCAGCTTGTTGCCCCC
AAGGCTCTCGCTCTCCCCGACGATGTCCGCCAGCAGATCGTTGCTTCCGGCCAGTTGGTCCTCGAGTCTGAGGAG
CTCACTCCTGAGATTGTCGCCAGCTCCGACATACTGTACTCCACTCGTGTGCAGAAGGAGCGCTTCGTCGACATT
CTTGAGTACGAGCGTCTCAAGAACACCTTTATCATCGACAACGCTCTGCTCAAGCACGCCAAGAGCCACATGGTT
GTCATGCATCCCCTCCCTCGCAATGCCGAGATCTCTGAGGAAGTCGACTTCGACCAGCGGGCTGCTTACTTCCGC
CAGATGCGCTACGGCCTCTACTGCCGCATGGCTCTCCTTGCTCTCGTCTTGGCGCCATGA
Gene >Pro_DTO377G3_2|g804.t1
ATGTCTCCCAATTCCCTTGAGGATCCAACTCTGCCTACCAGCCCACACCTGGGTAGTGTAGTCGGATACCCAGAG
GCCCAGTCCAACATGGATTCCGTCAGTGGAGTGATCAAGCCGGCCTCCATCCCAATTCGGGGTGGCTCAGACCGG
TTGGTCGCCCTCGAACTCGCAGATGGTACTGTCTACCAAGGTTACAACTTTGGTGCTGAAAAGAGTGCCTCGGGT
GAATTGGTCTTCCAGACTGGTATGGTCGGTTATCCCGAGTCTATCACCGACCCTTCATACCGTGGCCAGATCCTG
GTCATCACTTTCCCGCTCGTGGGTAACTACGGTGTCCCTTCGCACGATGAGATGTGTGAGCTCCTGAAGGACTTG
CCCAAGCACTTCGAGTCCAGTCAGATTCACATTTCGGCCTTGGTGGTGGCATCCTACGCCGGTGAGGATTACTCG
CACTTCTTGGCCAAGTCCTCCCTGGGCGATTGGCTCAAGTCCGAGGGCATTCCGGCTATGCACGGTGTCGACACT
CGTGCTTTGACTAAGCGCCTTCGTGAGACCGGTAGCATGCTGGGTCGCATGTTGCTGCAAAAGTCTGGCTCCCCT
CCTGATGTTGCTGCTACTAGCGGTGTCGACTGGAAGTCACACTTCGAGGAGACTGAATGGGTGGATCCCAACACA
AAGAACCTCGTCGCTGAGGGTGAGTGATCTACCAAGCTTCTACATGAAAAAGTAAAGGTTTTCTGACATCATTTT
TTTATTCTTACAGTCTCGATTCGCGAACCTCGCCTATTCACACCCCCCGCCAATGTCGCCCTCAAACACCCCTCG
GGCCGTGGAGTCCGCGTCCTTTGCTTGGATGTCGGTATGAAGTACAACCAGCTGCGTTGTTTGCTTGCCCGCGGT
GTCGAGGTTCTGGTTGTGCCATGGGACTATGATTTCCCCACCCTTGCTGGAAAGGACTTCGACGGTCTCTTCGTG
TCCAACGGTCCTGGTGATCCCGCGACCCTTACTGTTACCATTAAGAACCTGACCAAGATGTTCGAGGATGCTCGT
ACTCCCGTCTTCGGTATCTGTCTGGGTCACCAGTTGATTGCTCGTGCTGTCGGCGCTCAGACTACCAAGATGAAG
TTCGGTAACCGTGGTCACAACATCCCCTGCACAAGCATGCTCTCTGGCAAGTGCCACATTACTTCCCAGAACCAT
GGTTTTGCTGTGGATGCCAGCAGCCTTCATAACGGATGGGAAGAGCTGTTCGTCAACGCCAATGACGGCAGCAAC
GAGGGTATTCGTCACACCAGCCGTCCCTTCTTCAGTGTTCAATTCCATCCCGAGAGCACACCCGGCCCCCGGGAT
ACCGAGTACCTGTTTGATGTGTTCATCAACACCATCCAGTCTACCATTGACTCCCCCGAGGCTCTCAACATGCCT
GTCTCCTTCCCCGGTGGCACCAAGGCCGATAATCTCCTGGCCGCCCCCAAAGTCTCGGTCAAGAAGGTTCTGGTT
CTTGGCTCCGGTGGTCTTAGCATTGGTCAGGCTGGAGAGTTCGATTACTCTGGCAGTCAAGCCATCAAGGCCTTG
AAGGAAGAGGGTATCTACACCATTTTGATCAACCCCAATATTGCCACCATTCAGACCTCCAAGGGTCTGGCTGAC
AAGGTTTACTTCCTGCCCGTCAACGCCGAGTTCGTCCGCAAGGTGATCAAGCACGAGCGTCCTGATGCCATCTAC
GTCACTTTCGGTGGCCAGACTGCCCTTTCCGTGGGTATCCAGCTTAAGGACGAGTTCGAAGAACTCGGCGTCAAG
GTCCTCGGTACCCCTATTGATACTATCATCACTACTGAGGATCGTGAGCTGTTTGCTCGCAGCATGGATTCCATC
AACGAGAAGTGCGCCAAGTCTGCCTCTGCTTCCACCCTCGAGGAGTCCCTGCGTGTGGTTGAGGACATTGGTTTC
CCCGTCATTGTTCGTGCCGCCTACGCTCTTGGTGGACTTGGCAGTGGTTTCGCGGAGGACATGGATCAGCTGAAG
GAGCTCTGCACTAAGGCTTTGGCCGTCAGCCCCCAGGTGCTGATTGAGCGCAGTATGAAGGGCTGGAAGGAGATT
GAATACGAGGTTGTTCGTGATGCCCAGGACAACTGCATCACTGTCTGCAACATGGAGAACTTCGATCCCCTTGGT
ATTCACACTGGTGACTCCATTGTCGTTGCTCCTTCCCAGACCCTCTCAGACGAAGACTACAACATGCTACGAACC
ACCGCAGTCAACGTCATTCGTCACCTCGGTGTTGTCGGTGAATGTAACATTCAGTATGCCCTCAACCCCTTCTCG
AGGGAGTACTGTATCATTGAAGTCAACGCTCGTCTGTCTCGGTCCTCCGCCCTGGCCTCTAAGGCTACCGGATAC
CCTCTTGCTTTCATTGCTGCCAAGTTGGGTCTTGGTATCCCCCTGAATGAGATTAAGAATTCGGTCACCCAGTCC
ACTTGCGCCTGCTTCGAGCCATCGCTCGACTACTGCGTGGTTAAGATTCCTCGTTGGGATCTGAAGAAGTTTACC
CGTGTGTCTACTCAGCTTGGTTCTTCCATGAAGAGTGTCGGTGAAGTTATGAGCATTGGCCGAACCTTCGAGGAA
GCTATTCAGAAGGCTATTCGCTCGGTTGATTTCCACAACGTTGGTTTCAATGAGTCCGATGCCCTCATGTCCATC
AAGGGCGAGCTCCAGACTCCCTCCGACCAGCGTCTGTTTGCCATTGCCAATGCCATGGCCGCCGGTTACACTGTT
GATGACATCTGGAAACTCACCAACATTGACAAGTGGTTCCTCAGCCGACTCAAGGGCCTCAGCGACTTCGGCAAG
TCCATGTCCACCTTCAATGCTACCACTGTGCCTGTGCCTATGATCCGACAGGCCAAGCAGCTTGGTTTCTCCGAT
CGTCAGCTCGCCAACTTCTTGGACTCCAACGAGCTTGCTGTGCGCCGCATGCGTGTTGAGGCTGGTATCACACCT
ATCGTCAAGCAGATTGATACTGTTGCCGCCGAATTCCCAGCCGTGACCAACTACCTATACCTCACCTATAATGCT
TCTCAGCATGACCTGACGTTCGACGATCACGGTATCATGGTTCTGGGTTCTGGTGTCTACCGTATCGGTTCCTCT
GTCGAATTCGATTGGTGTTCCGTGCGTACCATTCGTACGCTCCGCGAGCAGGGCTACAAGACTATCATGGTCAAC
TACAACCCGGAGACCGTTAGTACCGATTACGATGAGGCCGACCGCCTTTACTTCGAGAACATCAACCTGGAGACT
GTTCTGGACATTTACCAGCTGGAGACTTCCAGCGGTGTGATCATGTCCATGGGTGGTCAGACCCCGAACAACATC
GCTCTGCCTCTTCACCGCCTCAATGTCAACATCCTGGGTACTTCCCCCGAGATGATTGATGGTGCTGAGAACCGT
TACAAGTTCTCCCGCATGTTGGATCGTATCGAAGTTGATCAGCCCGCTTGGAAGGAGCTGACTAGCATTGACGAG
GCCCGCGATTTCTGTGACAAGGTCGGCTACCCCGTGCTGGTCCGTCCTTCATACGTGCTCTCTGGTGCTGCCATG
AACACTGTGTATTCCGAGCACGATCTGGCCAGCTATTTGAACCAGGCTGTCGATGTTTCGCGTGAGCACCCTGTG
GTTATCACTAAGTATATCGAAAACGCCAAGGAGATTGAGATGGACGCTGTTGCCCGTAACGGTGTTATGGTTGGC
CACTTCATCTCCGAGCACGTTGAAAATGCTGGTGTTCACTCTGGTGACGCTACTCTGATCCTACCTCCCCAGGAT
TTGAGCCCGGAGACCGTGCGTCGCATTGAGGAGGCTACCCGGAAGATCGGTAATGCTCTGAACGTTACTGGCCCT
TACAACATTCAGTTCATTGCCAAGGATAATGACATCAAGGTCATTGAGTGTAACGTTCGTGCCTCGCGATCGTTC
CCCTTCGTGTCCAAGGTCATGGGTGTTGACCTCATCGAGATGGCCACCAAGGCCATGATGGGAATTCCATTCCAG
GAGTACCCCCCTGTGTCAATTCCTAAGGACTACGTCGGTGTTAAGGTCCCCCAGTTCTCGTTCTCACGTCTGTCC
GGTGCCGACCCCGTCCTGGGTGTCGAGATGGCCTCTACTGGTGAGGTTGCCTCGTTCGGTCGTGACAAGTACGAG
GCCTACCTGAAGGCTCTGTTGTCCACTGGATTCCGTCTTCCCCGCCGCAACATTCTGTTCTCCATTGGTTCCTAC
AAGGAGAAGCTTGAGATGCTACCCTCGATCAAGAAGCTCCACAATCTTGATTACAACCTGTTCGCCACTGCTGGT
ACCGCTGATTTCCTTAAGGAGAACGGCGTGCCTGTCAAGTACCTTGAGCATCTTCCGGACCACGAGGAGGAGCAG
ATGAAGTCTGAGTACTCTCTCACCCAGCACTTGTCCAACAACCTCATCGATCTGTACATCAACTTGCCGTCCAAC
AACCGCTTCCGCCGCCCTGCCAACTACATGTCCAAGGGTTACCGTACTCGTCGTATGGCTGTTGACTACCAGACT
CCTCTGGTCACCAACGTGAAGAATGCGAAGATCTTGATCGAGGCTATTGCTCGCCACTTCCCTCTGAACATCATC
CCCGCCGACTACCAGACTAGCCACCGCACTGTGGTCCTCCCCGGTTTGATCAATATTGCTGCGTTCGTCCCGAAC
CTTGTCTCCGTTGGTTCCAAGGACTTCGAAGCTGTTTCCAAGGCTTCGATTTCAGGTGGTTTCAGCATGATCCGT
GTGATGCCTGTCGGTGTTCACAGCTCGGTCACATCGGCCCGCGACCTCAAGATTGTCCAGCAGAACGCTCTGGGC
AAGTCGCTCTGCGACTTCAACATCTCTGTTGCTGCCACTGCCACCAACTCAGACCAGATCATCCAGATGACTGGT
GAGGTTGGCTCTCTCTTCGTACCCTTCAACCACTTGTCGGGTAACATCAACAAGGTGGCCACTGTCACCAACCAC
TTCAGCTCCTGGCCCTCAAGCAAACCCCTGATCACGGATGCCAAGAGCAATGATCTCGCCTCGATTCTGTTGTTG
GCCAGCCTCCACAGCCGTAACATTCACGTCATGAGTGTTACCTCCAAGGAGGATATCAGCCTTATTGCTCTGAGC
AAGGAGAAGGGCCTGAAGGTGACCTGCGATGTTGCTATCTACTGCCTTTTCCTTTCCCGCGAGGATTTCCCGACC
TGCAGCTTCCTGCCCACCGCCGAGGACCAGCAGGCTCTATGGGACCATATGAGCACCATCGATATCTTCTCTATT
GGCAGCATTCCCTTCCAGCTTGCTGGCAAGCAGGCTACTCCCGAGTCCGGCATCGCTGAGGCTATTCCTCTGCTG
TTCACCGCTGTCGCCGAGGGCCGCCTGACCATTGAGGACATCACCGCTCGTCTCTATGAGAACCCCAAGAAGATC
TTCGAGCTGCACGACCAGGCCGATAGCTCGCTCGAGGTCGAGGTTGACCGCCCCTACGTTTTCCAGAATCCCCAA
GCCTGGTCTCCGTTCAACGGCAAGACGTTGCGTGGCTCCGTTCAGCGTGTTGTTTTCCAGGGCAAGACCACCTGC
CTCGATGGCGAGATCACCAAGGATGCCATCAAGGGTACCGACATGTCCACTCACCGTATCGTCCCTACCTCGCCT
GTGCTGAAGCCCGTGACCCCCATGGTTCGCCCGGAGAGTTCCCTTGACAAACACGGGTCTATCGGTGGTACTCCT
GGCCGCCGCTTCCGGGCCCTGTCCAGCGCTGTCGGCGAACTTGGTCCTCCTCTTTACGTCGCCTCCTCGCAGGTC
TCACCCTCGCTGGCTGATATGCTCTCCCGATCTGCTTTCCGGGGAAAGCACATCCTGTCTGTGAACCAGTTCTCT
CGCGCCGACTTGCACCTGCTGTTCACCGTCGCTCAGGAGATGCGTCTTGGAGTCCAGCGCCACGGTGTTCTTGAC
CTCCTGAAGGGCCGTGTTTTGACCACCCTCTTCTACGAGCCCTCCACGCGCACCTCGGCCTCTTTCGACGCCGCC
ATGCAGCGCCTCGGTGGACGTACCATTGCCATCTCCACTCAGCACTCTTCTACCCAGAAGGGTGAGTCTCTCCAG
GACACCATCCGCACTCTCGGCTGCTACGGTGACGCTGTTGTTCTGCGCCACCCCGACTCGACCAGCACCGAGATC
GCGGCCAAATACTCCCAGGTCCCCGTCATCAACGGTGGCAACGGTGCCCTTGAGCACCCCACCCAGGCCTTCTTA
GACTTGTTCACCATCCGCGAGGAGTTGGGCACTGTCACCGGGTTGACCATCACCTTCACTGGTGATCTCAAGTAC
GGCCGCCCCGTGCACTCCCTCATCAAGCTGCTCCAGTTCTACGATGTCCGCATCCAGCTTGTTGCCCCCAAGGCT
CTCGCTCTCCCCGACGATGTCCGCCAGCAGATCGTTGCTTCCGGCCAGTTGGTCCTCGAGTCTGAGGAGCTCACT
CCTGAGATTGTCGCCAGCTCCGACATACTGTACTCCACTCGTGTGCAGAAGGAGCGCTTCGTCGACATTCTTGAG
TACGAGCGTCTCAAGAACACCTTTATCATCGACAACGCTCTGCTCAAGCACGCCAAGAGCCACATGGTTGTCATG
CATCCCCTCCCTCGCAATGCCGAGATCTCTGAGGAAGTCGACTTCGACCAGCGGGCTGCTTACTTCCGCCAGGTA
TGTTTCTGAATTTCCCTTGCTGTCTCTGAACAATGAACTAATTGCATTATAGATGCGCTACGGCCTCTACTGCCG
CATGGCTCTCCTTGCTCTCGTCTTGGCGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail