Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8038.t1
Gene name
Locationscaffold_28:177522..185482
Strand-
Gene length (bp)7960
Transcript length (bp)7605
Coding sequence length (bp)7605
Protein length (aa) 2535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 8.6E-72 24 274
PF08659 KR KR domain 6.8E-60 2173 2350
PF14765 PS-DH Polyketide synthase dehydratase 9.9E-60 984 1295
PF00698 Acyl_transf_1 Acyl transferase domain 7.5E-44 570 846
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 3.2E-38 283 400
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.4E-14 403 540
PF00106 adh_short short chain dehydrogenase 1.1E-12 2177 2331
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.3E-08 2182 2321
PF08242 Methyltransf_12 Methyltransferase domain 1.7E-07 1464 1570
PF08241 Methyltransf_11 Methyltransferase domain 8.6E-05 1464 1571

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8038.t1
MSSQTSDKPPKATVLQDDPANLAIAIVGIGFRGPGDAKNVEKLWEMILTGREAWSPIPAERWNSAAFYHPDHARH
GTINVEGGHFLKDDVSVFDAPFFNMTSDEAAAMDPQQRLLLEVAYEGLENAGIPLTKIMGTKTSCFVGSFSADYT
DLLLRDPECVPMYQCTNAGQSRAMAANRLSYFFDLKGPCVTVDTACSGSLVALHLACQSLQTGDSSIAIAAGVNL
ILSHEFMSTMSMMKFLSSDGRCHTFDEKASGYARGEAAGCLILKPLAKALHDHDKIRAVIRGTGSNQDGRTAGIT
LPNGAAQESLIRSVYTRADLDPSETDFVEAHGTGTLAGDPIETGAIARVFGTGRPPDNPVRIGSIKTNVGHLEGA
SGVAGVIKAVLMLENRMFLPNRNFETINPRIPLDDWKLKVQLRPEPWATTGPRRVSVNSFGYGGSNAHVIVEDAQ
SCLSSWGFKEYDIIQSTATKYHNETPPSLPRGLSRIFMLSGFDERTCAQQMQALSNHILDRGHEVDHEKFLDELA
FTINERRSVFPWKAAIVGDTMAGLAASLSQNIKARSAVRQPTLGFVFTGQGAQWAGMGKELLQAYPVFKRSISGI
DRFLNDIGAPFTVEEEITKCPQDSHLNHPSLSQTVCTAIQIALVDLLESWNIHPDSVTGHSSGEIAAAYATGALI
MDDAMSLAYYRGVVASQLLHDQPNRGAMMAVGMSAEEIQPYLDGFQPRQLVVACINSPSSVTISGDTLAIDALAQ
TLKEQEVFSRRLEVGVAYHSPHIEQVAEKYYSLIDHIQPRGLDQIAGDKRGRSGSFFSSVTGTMIPLEELDAQYW
VSNLVGQVKFANSLRSLCFETNSQRAGNTGGSRIRKAGAARKPSVDCLIEIGPHAALSGPIKQVLQADAKLNAAD
ITYISILTRKANAVTTALRAVATLGSLNCPIEFSAINRPMGRSKSGTLQLLVDLPTYAWNHTRSYWAEPRLSKMY
RNRTSPRMDLLGAPDNMACPFEPRWRNYLRTSELPWLLDHRIQGNIVFPAAGYLVMAIEASAQLSKDEEKFARYV
LRDVAIQAALVLNETSGVEVMVSLQKTTQDQEQLYNFHIYSISEDNRWTEHCTGLVGTQKSIGISGDGVEETDGY
ATVPLGTEIHGISVIDVRNFYDKLQNSGLEYGPCFANITKARVTQDGTCLAEVTVPDTLSVMPASFQHELLVHPC
TLDSMFHTIFAALPPGMGLEEGPAIPVSIEEMIVSSSLSCPAGEPMSICTHVRPMPNKDVTACIVAVNYNATQFE
TEPTISLRGLRCARLERHEPASQTKDNRTIYHIDWKPNPSFISSKNASFLFGREDAIQEPVLRAEHDESAAGFIR
AALGEVSTTEAMGLDPSHRTFRCYLQDVLERNDKPSISLSHLENINSAPMGRLLSVIGQNLAAIIRHQVDFSTVI
KDDRLLDEFWDLFSADASYQAAAKYVSLIGHGKPDISILELGVGTGQIAEIILQHLVTLNETACCGKYTFAHESA
SVLEHTSKRLEAWSKWVECKPLDLGKDFSKQGFEKNSFDVIILPHGLCTARCEQYALNKIRDLLRPSGYLIATNP
FDPKKDVLKNLLFSALHCLSADEFCLGQGGWTTSQWDEILQDAHFTEVDAYGEQDSEKSHQFIVARKRKAQKSPR
KVSIICENETEAARNLVTALENTSCEVNVIHIDNLECKDHICLVLDTPNSSLLASPNETTFSKIKVMFAQSGGVL
WVTKGGMIEPVNPTAALAVGFARTARAESGVKPIVTLDLDARNPLSESQAAEMIAKLLVARFLRETPDEDTEYAE
RNGQVLIPRVLENSKANMAMNGINDIEAVFEQPFYQLQKPLRLSRNSNNSGFVGDSQMTELPVGYIGIKVQSFGL
NKWDIQTDHLDWETDDTLGLECSGIVYKVGAEVHGITIGDRVACLGAGTARSFYHDRASAFQRINDEMSLQLASA
LPLAYTVAYYVVNHLSMVESNDVVLVHDAGSHFGQALLEVYLLRDARVFATVNGPDEKDLLSSRFGIPGEHVFIS
GKGDIAKGMLRSTDGKKANVVVTFQSAEDKMLQNCIAPFGRFIQLRTDNLKTRLLSHPRNMSLSTINIFGLQKER
TDLANQMWSKVSRLFLEGRLKGPGFTDVYHVSHIQEAMTAIKTRQHVVVHVEQSDLVKATLPRATQPLFHSDASY
MLVGGLGGIGREVALWMAKNGAKSLIFVNRSGLSKSHSQATVKNLAEEGIQVTTRACDISDETEVQRMLQDISCG
MPPIRGLIQAAMVLKDVHIENMMLDEYRDVMGPKYYGTWNLHRHLPTDLDFFLMLSSISGVIGNATQAAYAAGST
FMDAFAAYRRNLGLPTVSLDLGTITDVGHLAENRDLAAKMERQGFQGTDTPTLLSLIQVAISQSTSGAAQLVTGL
GRWKEMESLGNFDVPLFAHFRYKFQGHDKSTALDDSMEGLKVELAAAKTVDQATVIISDALSRKIASHLSIPIEN
INSSNPVSEYGIDSHVAVELRNWVSRSMDCTVPILEILARSMLELSHKIASQRFEGKSE*
Coding >Pro_DTO377G3_2|g8038.t1
ATGTCGTCACAAACCAGCGACAAACCCCCCAAAGCGACCGTTTTGCAAGATGACCCGGCAAACTTGGCAATAGCA
ATTGTGGGAATTGGCTTCCGGGGACCAGGGGATGCCAAAAATGTCGAGAAGCTGTGGGAAATGATTCTCACGGGT
AGAGAGGCATGGAGCCCAATTCCAGCTGAGAGGTGGAACAGTGCAGCATTCTATCACCCGGATCATGCCCGCCAT
GGAACGATCAATGTGGAAGGGGGTCACTTTTTGAAAGATGATGTATCTGTCTTCGACGCGCCGTTTTTCAACATG
ACAAGCGACGAGGCAGCGGCCATGGATCCACAGCAGAGATTGCTCTTGGAGGTAGCATATGAAGGTCTTGAAAAT
GCTGGCATTCCCCTGACCAAAATTATGGGCACAAAAACTTCCTGCTTTGTAGGGTCTTTCTCTGCAGACTATACG
GATCTCTTACTTCGGGATCCCGAGTGTGTGCCCATGTATCAGTGCACAAACGCCGGACAATCGCGTGCAATGGCG
GCAAACAGACTGTCTTATTTCTTTGATTTGAAAGGGCCCTGCGTCACGGTAGACACGGCTTGTTCTGGAAGCCTT
GTGGCACTTCATTTGGCATGCCAAAGCCTCCAGACAGGGGACTCATCAATAGCGATTGCAGCGGGAGTCAATTTG
ATCTTGAGTCACGAATTTATGTCAACGATGAGCATGATGAAGTTTCTCTCCTCAGATGGAAGATGCCATACCTTT
GATGAAAAGGCTAGTGGTTACGCGCGAGGCGAGGCAGCTGGCTGTCTCATCCTCAAACCCCTGGCCAAGGCTCTA
CACGATCACGACAAGATCCGGGCCGTGATACGAGGCACAGGTTCCAATCAGGACGGGCGTACTGCAGGAATAACG
CTACCTAACGGGGCAGCCCAAGAAAGCTTGATCAGGAGTGTCTATACAAGGGCTGATCTGGATCCCTCGGAAACC
GATTTTGTGGAGGCTCATGGGACAGGCACACTGGCTGGAGACCCAATTGAGACCGGGGCAATCGCTCGTGTCTTT
GGAACTGGTCGTCCGCCTGACAATCCTGTGCGAATTGGCTCCATCAAAACCAACGTCGGGCACTTGGAAGGCGCA
AGCGGAGTAGCGGGTGTGATCAAGGCAGTGCTAATGTTGGAAAACCGCATGTTCTTGCCAAACAGGAATTTTGAG
ACAATTAACCCGCGTATCCCACTCGACGATTGGAAACTCAAGGTTCAATTGCGCCCTGAGCCATGGGCGACTACG
GGCCCTCGTCGAGTTTCAGTGAACAGCTTCGGGTACGGGGGAAGCAATGCCCATGTTATTGTCGAAGATGCCCAA
AGCTGCTTATCGAGCTGGGGATTCAAAGAATATGACATAATCCAATCTACAGCGACTAAATATCATAACGAGACA
CCTCCTAGCCTGCCGCGTGGTTTATCTCGCATATTCATGCTCTCTGGGTTTGATGAAAGAACCTGTGCACAGCAG
ATGCAGGCTCTGAGCAATCATATTCTCGATAGGGGACATGAAGTTGACCATGAAAAGTTTCTGGACGAACTTGCC
TTCACAATAAACGAGCGACGATCTGTCTTTCCATGGAAGGCAGCCATTGTCGGAGATACGATGGCAGGTTTGGCA
GCCTCACTTTCTCAGAACATCAAGGCTAGGAGCGCCGTACGACAGCCAACCCTTGGGTTTGTCTTTACTGGACAA
GGCGCGCAGTGGGCTGGGATGGGAAAGGAGCTGCTTCAGGCCTATCCTGTCTTCAAAAGGTCGATTTCGGGTATT
GACAGATTTCTGAATGACATTGGAGCCCCTTTCACAGTGGAAGAGGAGATCACAAAGTGTCCCCAGGACTCCCAT
TTGAACCATCCAAGTCTCAGCCAAACAGTGTGCACAGCCATACAAATTGCGCTGGTCGACTTGCTGGAATCGTGG
AATATACATCCAGACTCCGTAACGGGTCATTCCAGTGGGGAGATCGCCGCTGCATATGCTACTGGAGCACTCATA
ATGGACGATGCAATGTCATTGGCATACTACCGAGGCGTTGTGGCAAGCCAGCTTCTGCATGACCAACCGAACAGA
GGTGCCATGATGGCAGTTGGGATGTCTGCCGAAGAGATACAGCCCTATCTGGACGGATTCCAGCCCCGACAGCTG
GTGGTAGCATGCATCAACAGTCCATCGAGTGTGACGATATCAGGTGATACACTTGCAATTGATGCACTCGCCCAA
ACCTTAAAAGAACAGGAGGTTTTTAGTCGACGCCTCGAAGTAGGTGTCGCGTATCATTCTCCTCATATAGAACAG
GTTGCCGAGAAGTATTACAGCTTGATAGACCATATCCAGCCCCGAGGACTGGATCAGATAGCGGGAGACAAGAGA
GGAAGGTCGGGGTCGTTCTTTTCCTCGGTCACTGGAACGATGATTCCTTTGGAAGAATTGGATGCTCAGTATTGG
GTGTCAAACTTGGTTGGACAAGTGAAATTTGCCAACTCGCTGAGGTCTTTGTGTTTTGAGACAAATAGTCAACGT
GCTGGGAATACAGGGGGTTCCCGAATACGAAAGGCTGGGGCAGCCCGAAAGCCTTCGGTGGATTGTCTGATCGAG
ATCGGTCCCCACGCGGCACTTTCTGGGCCGATCAAGCAGGTCCTCCAGGCGGATGCAAAACTCAATGCTGCCGAT
ATAACCTATATTAGCATTCTGACCCGGAAGGCCAACGCAGTTACTACAGCCCTCAGAGCAGTCGCCACACTAGGA
TCACTCAACTGCCCCATTGAATTTAGTGCAATCAACAGGCCCATGGGGAGAAGCAAGAGTGGCACGCTACAGTTA
CTGGTTGATCTTCCGACATATGCCTGGAATCACACCAGGTCATATTGGGCAGAGCCACGACTGAGCAAGATGTAT
CGAAACCGAACCTCGCCGCGGATGGATTTACTTGGTGCACCAGACAACATGGCATGTCCATTCGAGCCTCGCTGG
AGAAATTATCTTCGGACTTCGGAGCTCCCTTGGCTTCTTGATCACAGGATACAGGGGAACATTGTTTTCCCTGCC
GCAGGGTATTTGGTCATGGCAATTGAAGCATCAGCACAGTTGAGCAAAGACGAAGAAAAGTTTGCGAGATACGTG
CTGCGAGATGTGGCAATACAAGCAGCCCTGGTGCTCAACGAAACTTCTGGCGTCGAGGTTATGGTGTCTCTTCAA
AAGACGACGCAAGACCAAGAACAGTTGTACAATTTCCATATATACTCCATCTCGGAGGATAACAGGTGGACTGAG
CATTGCACTGGACTGGTCGGGACACAGAAAAGTATTGGCATTTCAGGCGACGGAGTCGAGGAAACTGATGGTTAT
GCGACGGTCCCGTTGGGAACTGAAATTCATGGAATATCAGTGATTGACGTCCGTAATTTCTATGACAAGCTTCAA
AATTCTGGTCTGGAATATGGGCCATGTTTTGCGAATATCACAAAAGCACGTGTCACTCAAGACGGAACGTGCCTT
GCAGAAGTCACTGTGCCAGATACACTATCTGTGATGCCAGCATCATTTCAGCATGAGCTTTTGGTCCATCCTTGC
ACGCTGGATAGTATGTTCCACACCATTTTTGCTGCTCTACCTCCAGGTATGGGGCTTGAGGAAGGACCTGCAATC
CCTGTTTCAATTGAAGAGATGATTGTATCATCCAGTCTCAGCTGCCCGGCAGGAGAACCCATGAGTATCTGTACC
CATGTGCGCCCGATGCCAAACAAGGACGTGACAGCATGCATAGTAGCAGTGAATTATAACGCGACGCAATTTGAA
ACCGAGCCAACCATTTCACTTCGTGGCCTGCGATGTGCACGGCTCGAGCGTCATGAACCCGCGTCGCAGACAAAG
GACAACCGTACAATCTATCATATTGACTGGAAACCCAATCCGAGTTTTATTTCCAGTAAGAATGCCTCGTTTCTA
TTTGGCAGGGAGGATGCTATTCAAGAGCCAGTCCTTCGAGCCGAGCATGATGAGAGTGCAGCTGGCTTCATCCGA
GCTGCGTTAGGGGAAGTCAGCACAACGGAGGCAATGGGACTTGATCCTTCTCATCGCACATTCCGGTGTTATCTC
CAAGACGTGCTTGAACGAAATGATAAACCCTCAATATCGTTATCTCACTTGGAAAATATCAATTCCGCCCCTATG
GGAAGGCTCCTGTCGGTCATTGGCCAAAACCTTGCGGCTATTATTAGACACCAAGTTGACTTTTCCACCGTCATC
AAGGACGATCGCCTTTTGGACGAGTTCTGGGATCTATTCTCAGCGGACGCCTCGTATCAAGCAGCTGCAAAGTAT
GTCAGTTTGATTGGCCACGGAAAGCCAGACATCTCCATCCTTGAACTTGGCGTTGGCACAGGCCAGATAGCGGAG
ATAATTCTACAGCATCTTGTGACGCTCAACGAGACAGCCTGTTGCGGGAAATATACATTTGCCCACGAAAGCGCT
TCCGTGCTGGAGCATACCTCGAAGCGGCTGGAGGCGTGGTCAAAATGGGTTGAGTGCAAGCCCCTGGATCTTGGC
AAGGATTTCTCCAAACAAGGATTTGAAAAAAATTCATTTGACGTCATAATCCTGCCTCATGGATTGTGTACTGCT
CGTTGTGAACAATATGCACTTAACAAGATCCGTGATCTTTTGAGACCATCTGGCTATTTGATTGCAACCAATCCC
TTCGACCCAAAGAAGGATGTGCTGAAAAATCTCTTGTTCAGTGCCTTGCACTGCTTATCTGCAGACGAATTTTGT
TTGGGCCAGGGTGGTTGGACAACGAGTCAATGGGATGAAATCCTGCAAGATGCGCATTTCACCGAGGTTGATGCC
TATGGGGAACAAGACTCCGAGAAGAGCCATCAGTTTATCGTTGCCAGAAAGCGAAAAGCCCAAAAGTCGCCCAGA
AAGGTATCTATTATTTGCGAAAACGAAACCGAGGCTGCCAGGAATCTAGTCACTGCGCTCGAGAATACTTCATGT
GAGGTGAATGTGATACACATCGATAATCTGGAGTGTAAGGATCATATTTGTTTGGTCTTGGATACACCGAACTCC
TCGCTGCTAGCCTCTCCCAATGAAACTACATTCAGCAAGATAAAAGTAATGTTTGCGCAGAGTGGAGGAGTCCTC
TGGGTCACAAAGGGAGGGATGATTGAGCCCGTCAACCCAACCGCGGCTTTGGCGGTTGGGTTTGCAAGAACAGCG
CGCGCCGAATCCGGTGTCAAACCGATTGTCACCCTTGACCTGGATGCTCGAAATCCTCTCTCGGAATCTCAAGCC
GCTGAGATGATCGCAAAACTTCTGGTTGCCCGATTTCTTCGTGAAACCCCTGATGAAGACACGGAATATGCGGAG
AGAAATGGGCAAGTCCTGATTCCACGAGTACTAGAGAATTCGAAGGCGAACATGGCTATGAACGGCATTAATGAC
ATTGAGGCTGTATTCGAGCAGCCTTTCTATCAGCTTCAAAAACCTCTCCGTCTTTCTAGAAATTCTAACAACTCC
GGCTTTGTTGGTGATTCGCAGATGACAGAACTCCCAGTCGGCTACATCGGAATCAAAGTTCAATCCTTCGGTCTG
AATAAATGGGATATTCAGACAGACCACCTTGACTGGGAAACAGACGACACTCTCGGTCTGGAGTGCAGTGGCATA
GTATACAAGGTCGGCGCCGAGGTCCACGGCATCACTATAGGGGACCGGGTTGCTTGTCTTGGAGCTGGGACTGCG
AGAAGCTTTTATCACGATCGGGCATCAGCTTTTCAGCGGATCAATGATGAAATGTCATTACAGCTGGCTTCGGCT
TTGCCTCTAGCATATACCGTTGCTTATTATGTTGTGAACCACCTCTCAATGGTCGAGTCAAATGATGTTGTTCTT
GTCCATGACGCTGGAAGCCACTTCGGCCAAGCACTTCTGGAAGTGTACCTGCTTAGGGATGCTCGGGTCTTTGCG
ACAGTGAACGGCCCCGACGAAAAGGACTTGCTGAGCTCGAGGTTCGGGATACCTGGGGAGCATGTCTTCATAAGC
GGGAAGGGAGATATAGCCAAGGGGATGTTGCGGTCAACTGATGGCAAGAAAGCGAATGTAGTAGTCACATTCCAG
AGCGCAGAGGATAAAATGCTCCAGAACTGCATTGCGCCATTTGGTCGGTTTATTCAACTTCGAACAGACAACCTC
AAGACCCGGCTCTTATCACACCCTCGAAACATGTCCCTGTCCACAATCAATATATTTGGGCTTCAAAAGGAGAGG
ACTGACCTTGCCAACCAGATGTGGTCGAAGGTCTCTCGCTTGTTCCTAGAAGGACGACTCAAAGGGCCTGGCTTT
ACTGATGTATATCATGTTTCACATATTCAAGAGGCAATGACGGCAATCAAGACCCGACAGCATGTTGTGGTTCAT
GTGGAACAGAGTGATCTTGTGAAGGCCACGCTCCCTAGGGCTACTCAGCCATTGTTCCACTCAGATGCGTCATAT
ATGCTCGTTGGTGGACTTGGTGGAATTGGGAGGGAGGTTGCTCTGTGGATGGCAAAAAACGGAGCGAAGAGTCTC
ATTTTCGTCAATCGAAGTGGCCTTTCAAAGTCTCATTCTCAGGCAACAGTGAAGAATCTGGCGGAAGAAGGTATC
CAGGTAACTACTCGAGCTTGTGACATATCCGACGAGACCGAAGTGCAGCGAATGCTTCAAGATATCTCTTGTGGC
ATGCCTCCAATACGGGGACTGATCCAGGCAGCCATGGTCCTCAAGGATGTTCATATTGAAAACATGATGTTGGAC
GAGTATCGGGATGTCATGGGCCCGAAGTATTATGGCACTTGGAATTTGCACCGACATCTCCCTACCGATCTTGAC
TTCTTCTTGATGTTATCGTCTATAAGCGGCGTTATAGGAAATGCCACACAGGCTGCCTATGCGGCCGGCAGCACT
TTCATGGATGCATTCGCCGCTTATCGAAGAAATTTAGGTCTTCCAACAGTATCTTTGGATCTCGGAACGATTACA
GATGTTGGCCATTTGGCTGAAAACAGAGATTTAGCGGCAAAGATGGAACGGCAAGGATTCCAGGGAACTGATACA
CCAACTCTTTTATCCCTGATACAAGTTGCAATTTCTCAGTCAACTAGCGGAGCAGCACAACTCGTAACGGGCCTC
GGCCGATGGAAAGAAATGGAATCACTTGGGAACTTTGATGTGCCCCTGTTTGCCCATTTCCGGTACAAGTTCCAG
GGCCATGACAAATCTACTGCGCTTGACGACTCGATGGAAGGATTAAAGGTTGAACTTGCGGCCGCAAAAACGGTG
GATCAAGCTACCGTTATAATCTCCGACGCTCTCAGCAGGAAAATTGCCTCGCATCTCTCTATCCCCATTGAAAAT
ATCAATTCTTCCAATCCGGTCTCCGAGTATGGAATTGACTCCCACGTGGCCGTGGAGCTGCGCAACTGGGTATCA
AGGTCCATGGACTGCACTGTCCCCATTTTGGAGATTCTAGCAAGGTCTATGTTGGAGTTGTCTCATAAAATTGCC
AGCCAAAGATTCGAGGGCAAGTCGGAGTGA
Transcript >Pro_DTO377G3_2|g8038.t1
ATGTCGTCACAAACCAGCGACAAACCCCCCAAAGCGACCGTTTTGCAAGATGACCCGGCAAACTTGGCAATAGCA
ATTGTGGGAATTGGCTTCCGGGGACCAGGGGATGCCAAAAATGTCGAGAAGCTGTGGGAAATGATTCTCACGGGT
AGAGAGGCATGGAGCCCAATTCCAGCTGAGAGGTGGAACAGTGCAGCATTCTATCACCCGGATCATGCCCGCCAT
GGAACGATCAATGTGGAAGGGGGTCACTTTTTGAAAGATGATGTATCTGTCTTCGACGCGCCGTTTTTCAACATG
ACAAGCGACGAGGCAGCGGCCATGGATCCACAGCAGAGATTGCTCTTGGAGGTAGCATATGAAGGTCTTGAAAAT
GCTGGCATTCCCCTGACCAAAATTATGGGCACAAAAACTTCCTGCTTTGTAGGGTCTTTCTCTGCAGACTATACG
GATCTCTTACTTCGGGATCCCGAGTGTGTGCCCATGTATCAGTGCACAAACGCCGGACAATCGCGTGCAATGGCG
GCAAACAGACTGTCTTATTTCTTTGATTTGAAAGGGCCCTGCGTCACGGTAGACACGGCTTGTTCTGGAAGCCTT
GTGGCACTTCATTTGGCATGCCAAAGCCTCCAGACAGGGGACTCATCAATAGCGATTGCAGCGGGAGTCAATTTG
ATCTTGAGTCACGAATTTATGTCAACGATGAGCATGATGAAGTTTCTCTCCTCAGATGGAAGATGCCATACCTTT
GATGAAAAGGCTAGTGGTTACGCGCGAGGCGAGGCAGCTGGCTGTCTCATCCTCAAACCCCTGGCCAAGGCTCTA
CACGATCACGACAAGATCCGGGCCGTGATACGAGGCACAGGTTCCAATCAGGACGGGCGTACTGCAGGAATAACG
CTACCTAACGGGGCAGCCCAAGAAAGCTTGATCAGGAGTGTCTATACAAGGGCTGATCTGGATCCCTCGGAAACC
GATTTTGTGGAGGCTCATGGGACAGGCACACTGGCTGGAGACCCAATTGAGACCGGGGCAATCGCTCGTGTCTTT
GGAACTGGTCGTCCGCCTGACAATCCTGTGCGAATTGGCTCCATCAAAACCAACGTCGGGCACTTGGAAGGCGCA
AGCGGAGTAGCGGGTGTGATCAAGGCAGTGCTAATGTTGGAAAACCGCATGTTCTTGCCAAACAGGAATTTTGAG
ACAATTAACCCGCGTATCCCACTCGACGATTGGAAACTCAAGGTTCAATTGCGCCCTGAGCCATGGGCGACTACG
GGCCCTCGTCGAGTTTCAGTGAACAGCTTCGGGTACGGGGGAAGCAATGCCCATGTTATTGTCGAAGATGCCCAA
AGCTGCTTATCGAGCTGGGGATTCAAAGAATATGACATAATCCAATCTACAGCGACTAAATATCATAACGAGACA
CCTCCTAGCCTGCCGCGTGGTTTATCTCGCATATTCATGCTCTCTGGGTTTGATGAAAGAACCTGTGCACAGCAG
ATGCAGGCTCTGAGCAATCATATTCTCGATAGGGGACATGAAGTTGACCATGAAAAGTTTCTGGACGAACTTGCC
TTCACAATAAACGAGCGACGATCTGTCTTTCCATGGAAGGCAGCCATTGTCGGAGATACGATGGCAGGTTTGGCA
GCCTCACTTTCTCAGAACATCAAGGCTAGGAGCGCCGTACGACAGCCAACCCTTGGGTTTGTCTTTACTGGACAA
GGCGCGCAGTGGGCTGGGATGGGAAAGGAGCTGCTTCAGGCCTATCCTGTCTTCAAAAGGTCGATTTCGGGTATT
GACAGATTTCTGAATGACATTGGAGCCCCTTTCACAGTGGAAGAGGAGATCACAAAGTGTCCCCAGGACTCCCAT
TTGAACCATCCAAGTCTCAGCCAAACAGTGTGCACAGCCATACAAATTGCGCTGGTCGACTTGCTGGAATCGTGG
AATATACATCCAGACTCCGTAACGGGTCATTCCAGTGGGGAGATCGCCGCTGCATATGCTACTGGAGCACTCATA
ATGGACGATGCAATGTCATTGGCATACTACCGAGGCGTTGTGGCAAGCCAGCTTCTGCATGACCAACCGAACAGA
GGTGCCATGATGGCAGTTGGGATGTCTGCCGAAGAGATACAGCCCTATCTGGACGGATTCCAGCCCCGACAGCTG
GTGGTAGCATGCATCAACAGTCCATCGAGTGTGACGATATCAGGTGATACACTTGCAATTGATGCACTCGCCCAA
ACCTTAAAAGAACAGGAGGTTTTTAGTCGACGCCTCGAAGTAGGTGTCGCGTATCATTCTCCTCATATAGAACAG
GTTGCCGAGAAGTATTACAGCTTGATAGACCATATCCAGCCCCGAGGACTGGATCAGATAGCGGGAGACAAGAGA
GGAAGGTCGGGGTCGTTCTTTTCCTCGGTCACTGGAACGATGATTCCTTTGGAAGAATTGGATGCTCAGTATTGG
GTGTCAAACTTGGTTGGACAAGTGAAATTTGCCAACTCGCTGAGGTCTTTGTGTTTTGAGACAAATAGTCAACGT
GCTGGGAATACAGGGGGTTCCCGAATACGAAAGGCTGGGGCAGCCCGAAAGCCTTCGGTGGATTGTCTGATCGAG
ATCGGTCCCCACGCGGCACTTTCTGGGCCGATCAAGCAGGTCCTCCAGGCGGATGCAAAACTCAATGCTGCCGAT
ATAACCTATATTAGCATTCTGACCCGGAAGGCCAACGCAGTTACTACAGCCCTCAGAGCAGTCGCCACACTAGGA
TCACTCAACTGCCCCATTGAATTTAGTGCAATCAACAGGCCCATGGGGAGAAGCAAGAGTGGCACGCTACAGTTA
CTGGTTGATCTTCCGACATATGCCTGGAATCACACCAGGTCATATTGGGCAGAGCCACGACTGAGCAAGATGTAT
CGAAACCGAACCTCGCCGCGGATGGATTTACTTGGTGCACCAGACAACATGGCATGTCCATTCGAGCCTCGCTGG
AGAAATTATCTTCGGACTTCGGAGCTCCCTTGGCTTCTTGATCACAGGATACAGGGGAACATTGTTTTCCCTGCC
GCAGGGTATTTGGTCATGGCAATTGAAGCATCAGCACAGTTGAGCAAAGACGAAGAAAAGTTTGCGAGATACGTG
CTGCGAGATGTGGCAATACAAGCAGCCCTGGTGCTCAACGAAACTTCTGGCGTCGAGGTTATGGTGTCTCTTCAA
AAGACGACGCAAGACCAAGAACAGTTGTACAATTTCCATATATACTCCATCTCGGAGGATAACAGGTGGACTGAG
CATTGCACTGGACTGGTCGGGACACAGAAAAGTATTGGCATTTCAGGCGACGGAGTCGAGGAAACTGATGGTTAT
GCGACGGTCCCGTTGGGAACTGAAATTCATGGAATATCAGTGATTGACGTCCGTAATTTCTATGACAAGCTTCAA
AATTCTGGTCTGGAATATGGGCCATGTTTTGCGAATATCACAAAAGCACGTGTCACTCAAGACGGAACGTGCCTT
GCAGAAGTCACTGTGCCAGATACACTATCTGTGATGCCAGCATCATTTCAGCATGAGCTTTTGGTCCATCCTTGC
ACGCTGGATAGTATGTTCCACACCATTTTTGCTGCTCTACCTCCAGGTATGGGGCTTGAGGAAGGACCTGCAATC
CCTGTTTCAATTGAAGAGATGATTGTATCATCCAGTCTCAGCTGCCCGGCAGGAGAACCCATGAGTATCTGTACC
CATGTGCGCCCGATGCCAAACAAGGACGTGACAGCATGCATAGTAGCAGTGAATTATAACGCGACGCAATTTGAA
ACCGAGCCAACCATTTCACTTCGTGGCCTGCGATGTGCACGGCTCGAGCGTCATGAACCCGCGTCGCAGACAAAG
GACAACCGTACAATCTATCATATTGACTGGAAACCCAATCCGAGTTTTATTTCCAGTAAGAATGCCTCGTTTCTA
TTTGGCAGGGAGGATGCTATTCAAGAGCCAGTCCTTCGAGCCGAGCATGATGAGAGTGCAGCTGGCTTCATCCGA
GCTGCGTTAGGGGAAGTCAGCACAACGGAGGCAATGGGACTTGATCCTTCTCATCGCACATTCCGGTGTTATCTC
CAAGACGTGCTTGAACGAAATGATAAACCCTCAATATCGTTATCTCACTTGGAAAATATCAATTCCGCCCCTATG
GGAAGGCTCCTGTCGGTCATTGGCCAAAACCTTGCGGCTATTATTAGACACCAAGTTGACTTTTCCACCGTCATC
AAGGACGATCGCCTTTTGGACGAGTTCTGGGATCTATTCTCAGCGGACGCCTCGTATCAAGCAGCTGCAAAGTAT
GTCAGTTTGATTGGCCACGGAAAGCCAGACATCTCCATCCTTGAACTTGGCGTTGGCACAGGCCAGATAGCGGAG
ATAATTCTACAGCATCTTGTGACGCTCAACGAGACAGCCTGTTGCGGGAAATATACATTTGCCCACGAAAGCGCT
TCCGTGCTGGAGCATACCTCGAAGCGGCTGGAGGCGTGGTCAAAATGGGTTGAGTGCAAGCCCCTGGATCTTGGC
AAGGATTTCTCCAAACAAGGATTTGAAAAAAATTCATTTGACGTCATAATCCTGCCTCATGGATTGTGTACTGCT
CGTTGTGAACAATATGCACTTAACAAGATCCGTGATCTTTTGAGACCATCTGGCTATTTGATTGCAACCAATCCC
TTCGACCCAAAGAAGGATGTGCTGAAAAATCTCTTGTTCAGTGCCTTGCACTGCTTATCTGCAGACGAATTTTGT
TTGGGCCAGGGTGGTTGGACAACGAGTCAATGGGATGAAATCCTGCAAGATGCGCATTTCACCGAGGTTGATGCC
TATGGGGAACAAGACTCCGAGAAGAGCCATCAGTTTATCGTTGCCAGAAAGCGAAAAGCCCAAAAGTCGCCCAGA
AAGGTATCTATTATTTGCGAAAACGAAACCGAGGCTGCCAGGAATCTAGTCACTGCGCTCGAGAATACTTCATGT
GAGGTGAATGTGATACACATCGATAATCTGGAGTGTAAGGATCATATTTGTTTGGTCTTGGATACACCGAACTCC
TCGCTGCTAGCCTCTCCCAATGAAACTACATTCAGCAAGATAAAAGTAATGTTTGCGCAGAGTGGAGGAGTCCTC
TGGGTCACAAAGGGAGGGATGATTGAGCCCGTCAACCCAACCGCGGCTTTGGCGGTTGGGTTTGCAAGAACAGCG
CGCGCCGAATCCGGTGTCAAACCGATTGTCACCCTTGACCTGGATGCTCGAAATCCTCTCTCGGAATCTCAAGCC
GCTGAGATGATCGCAAAACTTCTGGTTGCCCGATTTCTTCGTGAAACCCCTGATGAAGACACGGAATATGCGGAG
AGAAATGGGCAAGTCCTGATTCCACGAGTACTAGAGAATTCGAAGGCGAACATGGCTATGAACGGCATTAATGAC
ATTGAGGCTGTATTCGAGCAGCCTTTCTATCAGCTTCAAAAACCTCTCCGTCTTTCTAGAAATTCTAACAACTCC
GGCTTTGTTGGTGATTCGCAGATGACAGAACTCCCAGTCGGCTACATCGGAATCAAAGTTCAATCCTTCGGTCTG
AATAAATGGGATATTCAGACAGACCACCTTGACTGGGAAACAGACGACACTCTCGGTCTGGAGTGCAGTGGCATA
GTATACAAGGTCGGCGCCGAGGTCCACGGCATCACTATAGGGGACCGGGTTGCTTGTCTTGGAGCTGGGACTGCG
AGAAGCTTTTATCACGATCGGGCATCAGCTTTTCAGCGGATCAATGATGAAATGTCATTACAGCTGGCTTCGGCT
TTGCCTCTAGCATATACCGTTGCTTATTATGTTGTGAACCACCTCTCAATGGTCGAGTCAAATGATGTTGTTCTT
GTCCATGACGCTGGAAGCCACTTCGGCCAAGCACTTCTGGAAGTGTACCTGCTTAGGGATGCTCGGGTCTTTGCG
ACAGTGAACGGCCCCGACGAAAAGGACTTGCTGAGCTCGAGGTTCGGGATACCTGGGGAGCATGTCTTCATAAGC
GGGAAGGGAGATATAGCCAAGGGGATGTTGCGGTCAACTGATGGCAAGAAAGCGAATGTAGTAGTCACATTCCAG
AGCGCAGAGGATAAAATGCTCCAGAACTGCATTGCGCCATTTGGTCGGTTTATTCAACTTCGAACAGACAACCTC
AAGACCCGGCTCTTATCACACCCTCGAAACATGTCCCTGTCCACAATCAATATATTTGGGCTTCAAAAGGAGAGG
ACTGACCTTGCCAACCAGATGTGGTCGAAGGTCTCTCGCTTGTTCCTAGAAGGACGACTCAAAGGGCCTGGCTTT
ACTGATGTATATCATGTTTCACATATTCAAGAGGCAATGACGGCAATCAAGACCCGACAGCATGTTGTGGTTCAT
GTGGAACAGAGTGATCTTGTGAAGGCCACGCTCCCTAGGGCTACTCAGCCATTGTTCCACTCAGATGCGTCATAT
ATGCTCGTTGGTGGACTTGGTGGAATTGGGAGGGAGGTTGCTCTGTGGATGGCAAAAAACGGAGCGAAGAGTCTC
ATTTTCGTCAATCGAAGTGGCCTTTCAAAGTCTCATTCTCAGGCAACAGTGAAGAATCTGGCGGAAGAAGGTATC
CAGGTAACTACTCGAGCTTGTGACATATCCGACGAGACCGAAGTGCAGCGAATGCTTCAAGATATCTCTTGTGGC
ATGCCTCCAATACGGGGACTGATCCAGGCAGCCATGGTCCTCAAGGATGTTCATATTGAAAACATGATGTTGGAC
GAGTATCGGGATGTCATGGGCCCGAAGTATTATGGCACTTGGAATTTGCACCGACATCTCCCTACCGATCTTGAC
TTCTTCTTGATGTTATCGTCTATAAGCGGCGTTATAGGAAATGCCACACAGGCTGCCTATGCGGCCGGCAGCACT
TTCATGGATGCATTCGCCGCTTATCGAAGAAATTTAGGTCTTCCAACAGTATCTTTGGATCTCGGAACGATTACA
GATGTTGGCCATTTGGCTGAAAACAGAGATTTAGCGGCAAAGATGGAACGGCAAGGATTCCAGGGAACTGATACA
CCAACTCTTTTATCCCTGATACAAGTTGCAATTTCTCAGTCAACTAGCGGAGCAGCACAACTCGTAACGGGCCTC
GGCCGATGGAAAGAAATGGAATCACTTGGGAACTTTGATGTGCCCCTGTTTGCCCATTTCCGGTACAAGTTCCAG
GGCCATGACAAATCTACTGCGCTTGACGACTCGATGGAAGGATTAAAGGTTGAACTTGCGGCCGCAAAAACGGTG
GATCAAGCTACCGTTATAATCTCCGACGCTCTCAGCAGGAAAATTGCCTCGCATCTCTCTATCCCCATTGAAAAT
ATCAATTCTTCCAATCCGGTCTCCGAGTATGGAATTGACTCCCACGTGGCCGTGGAGCTGCGCAACTGGGTATCA
AGGTCCATGGACTGCACTGTCCCCATTTTGGAGATTCTAGCAAGGTCTATGTTGGAGTTGTCTCATAAAATTGCC
AGCCAAAGATTCGAGGGCAAGTCGGAGTGA
Gene >Pro_DTO377G3_2|g8038.t1
ATGTCGTCACAAACCAGCGACAAACCCCCCAAAGCGACCGTTTTGCAAGATGACCCGGCAAACTTGGCAATAGCA
ATTGTGGGAATTGGCTTCCGGGGACCAGGGGATGCCAAAAATGTCGAGAAGCTGTGGGAAATGATTCTCACGGGT
AGAGAGGCATGGAGCCCAATTCCAGCTGAGAGGTGGAACAGTGCAGCATTCTATCACCCGGATCATGCCCGCCAT
GGAACGGTAAGTTATGCATGAGATGAATCCGAATACTTAATAACGTGAGAGTAGATCAATGTGGAAGGGGGTCAC
TTTTTGAAAGATGATGTATCTGTCTTCGACGCGCCGTTTTTCAACATGACAAGCGACGAGGCAGCGGTAAGTACA
GAGTTGAATGTTGTTGGGCTCATCTAATTATCAACCTACCAGGCCATGGATCCACAGCAGAGATTGCTCTTGGAG
GTAGCATATGAAGGTCTTGAAAATGGTAGGTTATTGCTCCGAATGACGTTTTCGAGGCTGATGATGGTGGATAGC
TGGCATTCCCCTGACCAAAATTATGGGCACAAAAACTTCCTGCTTTGTAGGGTCTTTCTCTGCAGACTATACGGA
TCTCTTACTTCGGGATCCCGAGTGTGTGCCCATGTATCAGTGCACAAACGCCGGACAATCGCGTGCAATGGCGGC
AAACAGACTGTCTTATTTCTTTGATTTGAAAGGGCCCTGCGTCACGGTAGACACGGCTTGTTCTGGAAGCCTTGT
GGCACTTCATTTGGCATGCCAAAGCCTCCAGACAGGGGACTCATCAATAGCGATTGCAGCGGGAGTCAATTTGAT
CTTGAGTCACGAATTTATGTCAACGATGAGCATGATGAAGTATGCAAGAAATTACCCGCAACCGGGAGACTAGAC
TGATTTAGTCACAGGTTTCTCTCCTCAGATGGAAGATGCCATACCTTTGATGAAAAGGCTAGTGGTTACGCGCGA
GGCGAGGCAGCTGGCTGTCTCATCCTCAAACCCCTGGCCAAGGCTCTACACGATCACGACAAGATCCGGGCCGTG
ATACGAGGCACAGGTTCCAATCAGGACGGGCGTACTGCAGGAATAACGCTACCTAACGGGGCAGCCCAAGAAAGC
TTGATCAGGAGTGTCTATACAAGGGCTGATCTGGATCCCTCGGAAACCGATTTTGTGGAGGCTCATGGGACAGGC
ACACTGGCTGGAGACCCAATTGAGACCGGGGCAATCGCTCGTGTCTTTGGAACTGGTCGTCCGCCTGACAATCCT
GTGCGAATTGGCTCCATCAAAACCAACGTCGGGCACTTGGAAGGCGCAAGCGGAGTAGCGGGTGTGATCAAGGCA
GTGCTAATGTTGGAAAACCGCATGTTCTTGCCAAACAGGAATTTTGAGACAATTAACCCGCGTATCCCACTCGAC
GATTGGAAACTCAAGGTTTGGATGTTCAGGAAAGCTAAAGATTGGAGACTAACGTCAGTAGGTTCAATTGCGCCC
TGAGCCATGGGCGACTACGGGCCCTCGTCGAGTTTCAGTGAACAGCTTCGGGTACGGGGGAAGCAATGCCCATGT
TATTGTCGAAGATGCCCAAAGCTGCTTATCGAGCTGGGGATTCAAAGAATATGACATAATCCAATCTACAGCGAC
TAAATATCATAACGAGACACCTCCTAGCCTGCCGCGTGGTTTATCTCGCATATTCATGCTCTCTGGGTTTGATGA
AAGAACCTGTGCACAGCAGATGCAGGCTCTGAGCAATCATATTCTCGATAGGGGACATGAAGTTGACCATGAAAA
GTTTCTGGACGAACTTGCCTTCACAATAAACGAGCGACGATCTGTCTTTCCATGGAAGGCAGCCATTGTCGGAGA
TACGATGGCAGGTTTGGCAGCCTCACTTTCTCAGAACATCAAGGCTAGGAGCGCCGTACGACAGCCAACCCTTGG
GTTTGTCTTTACTGGACAAGGCGCGCAGTGGGCTGGGATGGGAAAGGAGCTGCTTCAGGCCTATCCTGTCTTCAA
AAGGTCGATTTCGGGTATTGACAGATTTCTGAATGACATTGGAGCCCCTTTCACAGTGGAAGGTACACAGACACC
AGACTTCTAAAGGTCCCGTACACTGACATCATGAATGCAGAGGAGATCACAAAGTGTCCCCAGGACTCCCATTTG
AACCATCCAAGTCTCAGCCAAACAGTGTGCACAGCCATACAAATTGCGCTGGTCGACTTGCTGGAATCGTGGAAT
ATACATCCAGACTCCGTAACGGGTCATTCCAGTGGGGAGATCGCCGCTGCATATGCTACTGGAGCACTCATAATG
GACGATGCAATGTCATTGGCATACTACCGAGGCGTTGTGGCAAGCCAGCTTCTGCATGACCAACCGAACAGAGGT
GCCATGATGGCAGTTGGGATGTCTGCCGAAGAGATACAGCCCTATCTGGACGGATTCCAGCCCCGACAGCTGGTG
GTAGCATGCATCAACAGTCCATCGAGTGTGACGATATCAGGTGATACACTTGCAATTGATGCACTCGCCCAAACC
TTAAAAGAACAGGAGGTTTTTAGTCGACGCCTCGAAGTAGGTGTCGCGTATCATTCTCCTCATATAGAACAGGTT
GCCGAGAAGTATTACAGCTTGATAGACCATATCCAGCCCCGAGGACTGGATCAGATAGCGGGAGACAAGAGAGGA
AGGTCGGGGTCGTTCTTTTCCTCGGTCACTGGAACGATGATTCCTTTGGAAGAATTGGATGCTCAGTATTGGGTG
TCAAACTTGGTTGGACAAGTGAAATTTGCCAACTCGCTGAGGTCTTTGTGTTTTGAGACAAATAGTCAACGTGCT
GGGAATACAGGGGGTTCCCGAATACGAAAGGCTGGGGCAGCCCGAAAGCCTTCGGTGGATTGTCTGATCGAGATC
GGTCCCCACGCGGCACTTTCTGGGCCGATCAAGCAGGTCCTCCAGGCGGATGCAAAACTCAATGCTGCCGATATA
ACCTATATTAGCATTCTGACCCGGAAGGCCAACGCAGTTACTACAGCCCTCAGAGCAGTCGCCACACTAGGATCA
CTCAACTGCCCCATTGAATTTAGTGCAATCAACAGGCCCATGGGGAGAAGCAAGAGTGGCACGCTACAGTTACTG
GTTGATCTTCCGACATATGCCTGGAATCACACCAGGTCATATTGGGCAGAGCCACGACTGAGCAAGATGTATCGA
AACCGAACCTCGCCGCGGATGGATTTACTTGGTGCACCAGACAACATGGCATGTCCATTCGAGCCTCGCTGGAGA
AATTATCTTCGGACTTCGGAGCTCCCTTGGCTTCTTGATCACAGGATACAGGGGAACATTGTTTTCCCTGCCGCA
GGGTATTTGGTCATGGCAATTGAAGCATCAGCACAGTTGAGCAAAGACGAAGAAAAGTTTGCGAGATACGTGCTG
CGAGATGTGGCAATACAAGCAGCCCTGGTGCTCAACGAAACTTCTGGCGTCGAGGTTATGGTGTCTCTTCAAAAG
ACGACGCAAGACCAAGAACAGTTGTACAATTTCCATATATACTCCATCTCGGAGGATAACAGGTGGACTGAGCAT
TGCACTGGACTGGTCGGGACACAGAAAAGTATTGGCATTTCAGGCGACGGAGTCGAGGAAACTGATGGTTATGCG
ACGGTCCCGTTGGGAACTGAAATTCATGGAATATCAGTGATTGACGTCCGTAATTTCTATGACAAGCTTCAAAAT
TCTGGTCTGGAATATGGGCCATGTTTTGCGAATATCACAAAAGCACGTGTCACTCAAGACGGAACGTGCCTTGCA
GAAGTCACTGTGCCAGATACACTATCTGTGATGCCAGCATCATTTCAGCATGAGCTTTTGGTCCATCCTTGCACG
CTGGATAGTATGTTCCACACCATTTTTGCTGCTCTACCTCCAGGTATGGGGCTTGAGGAAGGACCTGCAATCCCT
GTTTCAATTGAAGAGATGATTGTATCATCCAGTCTCAGCTGCCCGGCAGGAGAACCCATGAGTATCTGTACCCAT
GTGCGCCCGATGCCAAACAAGGACGTGACAGCATGCATAGTAGCAGTGAATTATAACGCGACGCAATTTGAAACC
GAGCCAACCATTTCACTTCGTGGCCTGCGATGTGCACGGCTCGAGCGTCATGAACCCGCGTCGCAGACAAAGGAC
AACCGTACAATCTATCATATTGACTGGAAACCCAATCCGAGTTTTATTTCCAGTAAGAATGCCTCGTTTCTATTT
GGCAGGGAGGATGCTATTCAAGAGCCAGTCCTTCGAGCCGAGCATGATGAGAGTGCAGCTGGCTTCATCCGAGCT
GCGTTAGGGGAAGTCAGCACAACGGAGGCAATGGGACTTGATCCTTCTCATCGCACATTCCGGTGTTATCTCCAA
GACGTGCTTGAACGAAATGATAAACCCTCAATATCGTTATCTCACTTGGAAAATATCAATTCCGCCCCTATGGGA
AGGCTCCTGTCGGTCATTGGCCAAAACCTTGCGGCTATTATTAGACACCAAGTTGACTTTTCCACCGTCATCAAG
GACGATCGCCTTTTGGACGAGTTCTGGGATCTATTCTCAGCGGACGCCTCGTATCAAGCAGCTGCAAAGTATGTC
AGTTTGATTGGCCACGGAAAGCCAGACATCTCCATCCTTGAACTTGGCGTTGGCACAGGCCAGATAGCGGAGATA
ATTCTACAGCATCTTGTGACGCTCAACGAGACAGCCTGTTGCGGGAAATATACATTTGCCCACGAAAGCGCTTCC
GTGCTGGAGCATACCTCGAAGCGGCTGGAGGCGTGGTCAAAATGGGTTGAGTGCAAGCCCCTGGATCTTGGCAAG
GATTTCTCCAAACAAGGATTTGAAAAAAATTCATTTGACGTCATAATCCTGCCTCATGGATTGTGTACTGCTCGT
TGTGAACAATATGCACTTAACAAGATCCGTGATCTTTTGAGACCATCTGGCTATTTGATTGCAACCAATCCCTTC
GACCCAAAGAAGGATGTGCTGAAAAATCTCTTGTTCAGTGCCTTGCACTGCTTATCTGCAGACGAATTTTGTTTG
GGCCAGGGTGGTTGGACAACGAGTCAATGGGATGAAATCCTGCAAGATGCGCATTTCACCGAGGTTGATGCCTAT
GGGGAACAAGACTCCGAGAAGAGCCATCAGTTTATCGTTGCCAGAAAGCGAAAAGCCCAAAAGTCGCCCAGAAAG
GTATCTATTATTTGCGAAAACGAAACCGAGGCTGCCAGGAATCTAGTCACTGCGCTCGAGAATACTTCATGTGAG
GTGAATGTGATACACATCGATAATCTGGAGTGTAAGGATCATATTTGTTTGGTCTTGGATACACCGAACTCCTCG
CTGCTAGCCTCTCCCAATGAAACTACATTCAGCAAGATAAAAGTAATGTTTGCGCAGAGTGGAGGAGTCCTCTGG
GTCACAAAGGGAGGGATGATTGAGCCCGTCAACCCAACCGCGGCTTTGGCGGTTGGGTTTGCAAGAACAGCGCGC
GCCGAATCCGGTGTCAAACCGATTGTCACCCTTGACCTGGATGCTCGAAATCCTCTCTCGGAATCTCAAGCCGCT
GAGATGATCGCAAAACTTCTGGTTGCCCGATTTCTTCGTGAAACCCCTGATGAAGACACGGAATATGCGGAGAGA
AATGGGCAAGTCCTGATTCCACGAGTACTAGAGAATTCGAAGGCGAACATGGCTATGAACGGCATTAATGACATT
GAGGCTGTATTCGAGCAGCCTTTCTATCAGCTTCAAAAACCTCTCCGTCTTTCTAGAAATTCTAACAACTCCGGC
TTTGTTGGTGATTCGCAGATGACAGAACTCCCAGTCGGCTACATCGGAATCAAAGTTCAATCCTTCGGTCTGAAT
AAATGGGATATTCAGACAGACCACCTTGACTGGGAAACAGACGACACTCTCGGTCTGGAGTGCAGTGGCATAGTA
TACAAGGTCGGCGCCGAGGTCCACGGCATCACTATAGGGGACCGGGTTGCTTGTCTTGGAGCTGGGACTGCGAGA
AGCTTTTATCACGATCGGGCATCAGCTTTTCAGCGGATCAATGATGAAATGTCATTACAGCTGGCTTCGGCTTTG
CCTCTAGCATATACCGTTGCTTATTATGTTGTGAACCACCTCTCAATGGTCGAGTCAAATGATGTTGTTCTTGTC
CATGACGCTGGAAGCCACTTCGGCCAAGCACTTCTGGAAGTGTACCTGCTTAGGGATGCTCGGGTCTTTGCGACA
GTGAACGGCCCCGACGAAAAGGACTTGCTGAGCTCGAGGTTCGGGATACCTGGGGAGCATGTCTTCATAAGCGGG
AAGGGAGATATAGCCAAGGGGATGTTGCGGTCAACTGATGGCAAGAAAGCGAATGTAGTAGTCACATTCCAGAGC
GCAGAGGATAAAATGCTCCAGAACTGCATTGCGCCATTTGGTCGGTTTATTCAACTTCGAACAGACAACCTCAAG
ACCCGGCTCTTATCACACCCTCGAAACATGTCCCTGTCCACAATCAATATATTTGGGCTTCAAAAGGAGAGGACT
GACCTTGCCAACCAGATGTGGTCGAAGGTCTCTCGCTTGTTCCTAGAAGGACGACTCAAAGGGCCTGGCTTTACT
GATGTATATCATGTTTCACATATTCAAGAGGCAATGACGGCAATCAAGACCCGACAGCATGTTGTGGTTCATGTG
GAACAGAGTGATCTTGTGAAGGTATAGTTTATCCTAAGCACCGGAGGACGTCCATTTGCCTCCAGCTAATGTGAT
TTAGGCCACGCTCCCTAGGGCTACTCAGCCATTGTTCCACTCAGATGCGTCATATATGCTCGTTGGTGGACTTGG
TGGAATTGGGAGGGAGGTTGCTCTGTGGATGGCAAAAAACGGAGCGAAGAGTCTCATTTTCGTCAATCGAAGTGG
CCTTTCAAAGTCTCATTCTCAGGCAACAGTGAAGAATCTGGCGGAAGAAGGTATCCAGGTAACTACTCGAGCTTG
TGACATATCCGACGAGACCGAAGTGCAGCGAATGCTTCAAGATATCTCTTGTGGCATGCCTCCAATACGGGGACT
GATCCAGGCAGCCATGGTCCTCAAGGATGTTCATATTGAAAACATGATGTTGGACGAGTATCGGGATGTCATGGG
CCCGAAGTATTATGGCACTTGGAATTTGCACCGACATCTCCCTACCGATCTTGACTTCTTCTTGATGTTATCGTC
TATAAGCGGCGTTATAGGAAATGCCACACAGGCTGCCTATGCGGCCGGCAGCACTTTCATGGATGCATTCGCCGC
TTATCGAAGAAATTTAGGTCTTCCAACAGTATCTTTGGATCTCGGAACGATTACAGATGTTGGCCATTTGGCTGA
AAACAGAGATTTAGCGGCAAAGATGGAACGGCAAGGATTCCAGGGAACTGATACACCAACTCTTTTATCCCTGAT
ACAAGTTGCAATTTCTCAGTCAACTAGCGGAGCAGCACAACTCGTAACGGGCCTCGGCCGATGGAAAGAAATGGA
ATCACTTGGGAACTTTGATGTGCCCCTGTTTGCCCATTTCCGGTACAAGTTCCAGGGCCATGACAAATCTACTGC
GCTTGACGACTCGATGGAAGGATTAAAGGTTGAACTTGCGGCCGCAAAAACGGTGGATCAAGCTACCGTTATAAT
CTCCGACGCTCTCAGCAGGAAAATTGCCTCGCATCTCTCTATCCCCATTGAAAATATCAATTCTTCCAATCCGGT
CTCCGAGTATGGAATTGACTCCCACGTGGCCGTGGAGCTGCGCAACTGGGTATCAAGGTCCATGGACTGCACTGT
CCCCATTTTGGAGATTCTAGCAAGGTCTATGTTGGAGTTGTCTCATAAAATTGCCAGCCAAAGATTCGAGGGCAA
GTCGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail