Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8033.t1
Gene name
Locationscaffold_28:166157..166612
Strand-
Gene length (bp)455
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04568 IATP Mitochondrial ATPase inhibitor, IATP 4.3E-20 6 94

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0042030 ATPase inhibitor activity Yes
GO:0032780 negative regulation of ATP-dependent activity Yes
GO:0043462 regulation of ATP-dependent activity No
GO:0065007 biological regulation No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0065009 regulation of molecular function No
GO:0044092 negative regulation of molecular function No
GO:0140678 molecular function inhibitor activity No
GO:0043231 intracellular membrane-bounded organelle No
GO:0098772 molecular function regulator activity No
GO:0043227 membrane-bounded organelle No
GO:0008150 biological_process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8033.t1
MQSAISRPILRVTTNPTLLRSLSITPSIMSAGDTGATKSEFMGQKDSFARREAAHEAMYIRQVEMEKLENLKRKV
EEQRKHMNELDKHIDEYTRSQGGEQN*
Coding >Pro_DTO377G3_2|g8033.t1
ATGCAATCAGCAATTTCCCGACCCATTCTCCGTGTCACTACCAATCCAACTCTTCTCCGATCCCTCTCTATCACC
CCGAGCATCATGAGTGCAGGCGATACCGGTGCTACCAAGTCGGAGTTCATGGGCCAGAAGGACTCTTTCGCCAGA
CGCGAGGCTGCACACGAAGCCATGTACATTCGACAAGTTGAGATGGAGAAACTTGAGAATCTCAAACGAAAGGTC
GAGGAGCAGCGCAAGCATATGAATGAACTTGACAAACATATCGATGAGTATACTAGGTCCCAGGGAGGTGAACAG
AACTAG
Transcript >Pro_DTO377G3_2|g8033.t1
ATGCAATCAGCAATTTCCCGACCCATTCTCCGTGTCACTACCAATCCAACTCTTCTCCGATCCCTCTCTATCACC
CCGAGCATCATGAGTGCAGGCGATACCGGTGCTACCAAGTCGGAGTTCATGGGCCAGAAGGACTCTTTCGCCAGA
CGCGAGGCTGCACACGAAGCCATGTACATTCGACAAGTTGAGATGGAGAAACTTGAGAATCTCAAACGAAAGGTC
GAGGAGCAGCGCAAGCATATGAATGAACTTGACAAACATATCGATGAGTATACTAGGTCCCAGGGAGGTGAACAG
AACTAG
Gene >Pro_DTO377G3_2|g8033.t1
ATGCAATCAGCAATTTCCCGACCCATTCTCCGTGTCACTACCAATCCAACTCTTCTCCGATCCCTCTCTATCACC
CCGAGCATCATGAGTGCAGGCGATACCGGTGCTACCAAGTCGGAGTTCATGGGCCAGTATGGTGGCACAGTGCAA
AATAGATGACGTCATATCTGACTTTTGGCAGGAAGGACTCTTTCGCCAGACGCGAGGCTGCACACGAAGCCATGT
ACATTCGACAAGTTGAGATGGAGAAGTGAGTTACACTGCATCAAGTTCAATATATAAACTTACCTGGTGGTAGAC
TTGAGAATCTCAAACGAAAGGTCGAGGAGCAGCGCAAGCATATGAATGAACTTGACAAACATATGTGGGGATATC
CTGAATTTTCCCACTCGAGACCAACACTGACAGGTCATAGCGATGAGTATACTAGGTCCCAGGGAGGTGAACAGA
ACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail