Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8008.t1
Gene name
Locationscaffold_28:105157..109096
Strand+
Gene length (bp)3939
Transcript length (bp)3402
Coding sequence length (bp)3402
Protein length (aa) 1134

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 5.4E-10 856 1014
PF05057 DUF676 Putative serine esterase (DUF676) 1.8E-07 76 151

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0008324 cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 969 991 22
2 1011 1029 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6.31 3.02 9.60
5d_25C Five days - 25 degrees Celsius 14.09 8.01 20.17
7d_25C Seven days - 25 degrees Celsius 15.07 8.62 21.52
10d_25C Ten days - 25 degrees Celsius 24.84 14.90 34.77
7d_15C Seven days - 15 degrees Celsius 15.23 8.70 21.76
7d_30C Seven days - 30 degrees Celsius 18.34 10.77 25.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.001278 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.845680 no
5d_25C 7d_15C 0.816438 no
5d_25C 7d_30C 0.290696 no
5d_25C 10d_25C 0.006371 yes
7d_25C 7d_15C 0.978103 no
7d_25C 7d_30C 0.466355 no
7d_25C 10d_25C 0.023673 yes
7d_15C 7d_30C 0.496126 no
7d_15C 10d_25C 0.023429 yes
7d_30C 10d_25C 0.186413 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8008.t1
MPSRPPVNDQTRSWFEPVSLHDDTDVDIVAVPPVGAHHRETWIAPGAKLSWLDEELLQHVPRARVLLYNYGDLRD
DKIDTLGQRLLNQLHSEWTHESTRRPIFFICHSTGGLVVKAALAMASREASQSTLINCHGIAFFATPHQGSTYLS
ADEYAASIRRLLHLDCETPAALRMQLRPRQEHLWHLSNQFKTLSADMRVWSFLETVDSTMQVIDTETHNIMEFHV
PITSIRSGLLDIEHEKEVPMATDHAGTATFHGQESTRDRFLDELANAVATAVEISQREDIPLRVEEQVKVQINGF
FEDTALGVSDESPLKLWSTKVSLREYISRGPSACLRERLVRFRPSGLDHSPMGSYGRSRPGSSYVSPGSDPHHPQ
SHHDEKSRFLQAPIPYRPIFEDPSDPSPNIHITEADMEGYSSDAPNESPYPPQELKRKSSITKLVELIRPKQSHS
RSASDSSRTNIEQPHSTYSASQPVQSSFLAVPESIRDHINENADKPDIPRAVPRFDRPEADTEKLMWIHVPYTHT
GWVSQVIRRACEDRQEPNFVRKFINDENWYNRFNRARHLEPHARFVKPACIHSRQMDISERPSNPSKDPQLALYV
PYLHWDTYRNLIQRRKVVEDRLNQGRSKPVPSRISKASLEAQLIWSYLGCEPPVHFRRTLDQYGYPNLRSTIARD
DDQMLWKRTRRPARIDEQLKEYLQSAQDDPDNEDIGEFLDGNVLMVDQLWLWIVDQKTVVTFFPNQEAATSEGKL
FEQSNLHRSIYNELNGDLSRRFETAGDLAALIMLHAVTVLLDKTLNHDLQVLRIFEESISILTESVTKSFKRFRN
RGFTNRPADHDRTSDGKIMTAAQQDYKELQVARRNREDLSVLLELRDIEDELSTILKLLDQQDTVIKNMVKYFGN
KGCGKSFLDTAQERIDEYRSQINEMKENSHLAQKAVETLLDLKQKQANVDEAKMTRWQAEVAQTQSRAVMVFTIF
SVVFLPLSFFTSLFGINAREWSGEQANPTLGQMFEIAAPASFAIIFLSLFIAFSETLRDIVSKMHKIGAGLSKDF
ILHPIKSFLWGSATGKIPIHVVPEDSGLRKRFDEYLGYGRRNMQRDEDIWRRWQGDRISAGKGNKKGKYEINSGF
DRRRPGEV*
Coding >Pro_DTO377G3_2|g8008.t1
ATGCCTTCGCGGCCACCCGTGAACGACCAGACGCGCTCGTGGTTTGAGCCTGTTTCTCTCCATGACGATACTGAT
GTCGATATTGTCGCTGTCCCGCCCGTCGGCGCCCATCATAGAGAGACGTGGATAGCGCCTGGCGCGAAATTATCC
TGGCTTGATGAAGAGCTACTACAGCATGTGCCTCGAGCACGAGTCCTACTATATAACTATGGAGACCTACGTGAC
GACAAAATCGATACCTTGGGTCAACGACTGTTGAACCAACTCCATAGTGAGTGGACACATGAGTCAACTCGACGT
CCCATTTTTTTTATTTGCCACAGCACCGGTGGTCTCGTCGTCAAAGCAGCTCTGGCCATGGCATCACGAGAGGCG
AGCCAGTCGACCTTAATCAACTGTCATGGTATCGCCTTCTTTGCAACTCCCCATCAAGGCTCGACCTATCTCTCT
GCCGATGAATACGCGGCTAGTATACGTCGACTCCTGCATCTGGATTGTGAGACCCCGGCAGCGCTCAGGATGCAG
TTGCGTCCCCGTCAAGAGCACCTATGGCATCTGTCGAACCAGTTCAAAACCCTTTCGGCTGACATGAGGGTCTGG
TCTTTTCTCGAAACTGTGGATTCAACTATGCAGGTGATCGACACCGAGACTCATAACATAATGGAGTTTCATGTG
CCCATTACTTCGATTCGGTCGGGTTTGTTGGATATTGAGCATGAAAAAGAAGTGCCCATGGCAACGGACCATGCG
GGGACGGCAACTTTCCATGGCCAGGAGTCTACACGAGATCGATTCCTCGATGAGCTTGCTAATGCTGTGGCCACG
GCTGTTGAAATTTCCCAGCGCGAGGATATTCCGTTACGCGTGGAAGAGCAAGTCAAGGTTCAAATTAACGGCTTC
TTCGAGGATACTGCACTGGGTGTCAGTGACGAAAGTCCGCTCAAGCTGTGGTCAACCAAAGTGTCCCTGAGAGAG
TACATCTCTCGGGGTCCGTCAGCTTGTCTTCGGGAGAGACTAGTTCGATTCCGACCCAGTGGCTTGGACCATTCA
CCAATGGGCAGTTATGGTAGATCTAGACCCGGTTCATCCTACGTTTCTCCTGGCTCCGATCCACACCATCCTCAA
AGCCATCATGATGAGAAATCAAGGTTCCTGCAAGCCCCTATACCCTACAGGCCAATCTTTGAAGATCCATCCGAT
CCCTCTCCGAATATCCACATCACCGAAGCAGACATGGAGGGCTACTCGAGCGACGCACCCAATGAAAGCCCATAT
CCGCCACAGGAACTAAAACGAAAGAGCTCAATCACCAAGCTGGTGGAATTAATTCGACCTAAGCAATCCCACAGT
CGAAGTGCTTCTGACAGCTCCCGGACAAATATTGAACAGCCACATTCGACCTATTCTGCATCACAACCAGTGCAA
TCCTCTTTCCTGGCAGTACCCGAGTCCATTCGTGATCACATCAACGAGAATGCCGACAAACCGGATATACCTCGA
GCAGTTCCACGCTTCGATCGACCTGAGGCTGATACGGAGAAACTGATGTGGATTCATGTGCCATATACGCATACT
GGCTGGGTATCCCAAGTCATTCGCCGAGCATGTGAGGATAGGCAAGAGCCTAATTTTGTTCGGAAATTTATCAAT
GACGAAAATTGGTACAACCGGTTTAATAGAGCTCGTCACCTCGAGCCCCATGCACGTTTCGTCAAGCCCGCATGC
ATTCACTCCAGACAAATGGATATTTCAGAACGTCCTTCTAATCCTTCCAAGGATCCTCAGCTCGCTCTATATGTT
CCCTACCTCCACTGGGATACATATCGCAACCTAATCCAACGGCGTAAGGTGGTCGAAGATCGACTCAACCAGGGC
CGATCCAAGCCCGTCCCAAGCCGGATCTCAAAGGCAAGCCTGGAAGCCCAACTCATCTGGAGCTATCTCGGCTGC
GAACCTCCAGTACATTTCCGCCGCACATTGGATCAATATGGGTATCCCAATCTACGCTCGACTATCGCTCGTGAC
GACGACCAGATGCTTTGGAAGCGCACTCGCAGACCGGCGCGCATTGATGAGCAATTAAAAGAGTATCTGCAGTCT
GCACAGGATGATCCCGATAACGAGGATATTGGCGAGTTTCTAGATGGCAATGTCCTGATGGTTGATCAGCTCTGG
CTTTGGATTGTGGATCAAAAGACTGTTGTTACTTTCTTTCCGAATCAAGAGGCTGCGACCTCTGAGGGGAAGCTT
TTTGAACAGTCGAACTTGCATCGCAGCATTTATAATGAGTTGAATGGGGATCTCTCGCGTCGGTTTGAGACCGCC
GGTGACTTGGCTGCTCTTATCATGCTGCATGCTGTCACTGTTCTCCTGGATAAGACTCTCAATCATGATCTGCAG
GTATTGCGAATCTTCGAGGAGTCAATCAGCATATTGACCGAATCAGTGACGAAGTCTTTCAAGCGCTTTCGAAAT
AGAGGCTTCACCAACCGCCCAGCGGATCATGACCGCACCTCAGACGGCAAGATCATGACAGCCGCGCAGCAAGAT
TACAAAGAATTGCAGGTTGCTCGTCGAAATCGAGAAGATCTATCCGTTCTGCTTGAGCTGCGTGACATCGAAGAC
GAGCTATCCACCATCCTAAAGCTGCTCGATCAACAAGACACCGTTATCAAAAATATGGTGAAATACTTCGGTAAC
AAAGGGTGCGGTAAATCATTCCTCGATACAGCACAAGAGCGAATCGACGAATATCGTTCACAAATCAATGAGATG
AAAGAAAACAGCCATCTAGCGCAGAAAGCAGTGGAAACGCTCCTTGACCTCAAGCAGAAACAGGCAAATGTCGAC
GAAGCCAAGATGACTCGGTGGCAAGCTGAAGTTGCCCAAACGCAATCGCGAGCAGTGATGGTCTTCACCATATTC
AGTGTTGTCTTCCTCCCTCTATCTTTCTTTACCTCCTTGTTTGGAATCAATGCCCGAGAATGGAGCGGGGAACAG
GCAAACCCAACCCTAGGACAAATGTTCGAAATAGCAGCCCCGGCATCCTTTGCAATAATCTTCCTGTCCCTCTTC
ATAGCCTTCAGCGAAACGCTACGCGATATCGTATCCAAAATGCACAAGATCGGCGCGGGCCTATCGAAGGACTTC
ATCCTGCATCCGATTAAATCATTCTTATGGGGTTCTGCTACAGGTAAAATACCTATTCACGTCGTGCCTGAGGAC
TCTGGGCTTAGGAAACGCTTTGATGAGTATCTGGGTTATGGGAGGCGGAATATGCAGCGTGATGAGGATATCTGG
CGGCGGTGGCAGGGGGATCGAATTTCTGCGGGGAAGGGAAACAAGAAGGGGAAGTATGAGATAAATTCTGGATTT
GATCGGAGACGCCCCGGGGAGGTTTAG
Transcript >Pro_DTO377G3_2|g8008.t1
ATGCCTTCGCGGCCACCCGTGAACGACCAGACGCGCTCGTGGTTTGAGCCTGTTTCTCTCCATGACGATACTGAT
GTCGATATTGTCGCTGTCCCGCCCGTCGGCGCCCATCATAGAGAGACGTGGATAGCGCCTGGCGCGAAATTATCC
TGGCTTGATGAAGAGCTACTACAGCATGTGCCTCGAGCACGAGTCCTACTATATAACTATGGAGACCTACGTGAC
GACAAAATCGATACCTTGGGTCAACGACTGTTGAACCAACTCCATAGTGAGTGGACACATGAGTCAACTCGACGT
CCCATTTTTTTTATTTGCCACAGCACCGGTGGTCTCGTCGTCAAAGCAGCTCTGGCCATGGCATCACGAGAGGCG
AGCCAGTCGACCTTAATCAACTGTCATGGTATCGCCTTCTTTGCAACTCCCCATCAAGGCTCGACCTATCTCTCT
GCCGATGAATACGCGGCTAGTATACGTCGACTCCTGCATCTGGATTGTGAGACCCCGGCAGCGCTCAGGATGCAG
TTGCGTCCCCGTCAAGAGCACCTATGGCATCTGTCGAACCAGTTCAAAACCCTTTCGGCTGACATGAGGGTCTGG
TCTTTTCTCGAAACTGTGGATTCAACTATGCAGGTGATCGACACCGAGACTCATAACATAATGGAGTTTCATGTG
CCCATTACTTCGATTCGGTCGGGTTTGTTGGATATTGAGCATGAAAAAGAAGTGCCCATGGCAACGGACCATGCG
GGGACGGCAACTTTCCATGGCCAGGAGTCTACACGAGATCGATTCCTCGATGAGCTTGCTAATGCTGTGGCCACG
GCTGTTGAAATTTCCCAGCGCGAGGATATTCCGTTACGCGTGGAAGAGCAAGTCAAGGTTCAAATTAACGGCTTC
TTCGAGGATACTGCACTGGGTGTCAGTGACGAAAGTCCGCTCAAGCTGTGGTCAACCAAAGTGTCCCTGAGAGAG
TACATCTCTCGGGGTCCGTCAGCTTGTCTTCGGGAGAGACTAGTTCGATTCCGACCCAGTGGCTTGGACCATTCA
CCAATGGGCAGTTATGGTAGATCTAGACCCGGTTCATCCTACGTTTCTCCTGGCTCCGATCCACACCATCCTCAA
AGCCATCATGATGAGAAATCAAGGTTCCTGCAAGCCCCTATACCCTACAGGCCAATCTTTGAAGATCCATCCGAT
CCCTCTCCGAATATCCACATCACCGAAGCAGACATGGAGGGCTACTCGAGCGACGCACCCAATGAAAGCCCATAT
CCGCCACAGGAACTAAAACGAAAGAGCTCAATCACCAAGCTGGTGGAATTAATTCGACCTAAGCAATCCCACAGT
CGAAGTGCTTCTGACAGCTCCCGGACAAATATTGAACAGCCACATTCGACCTATTCTGCATCACAACCAGTGCAA
TCCTCTTTCCTGGCAGTACCCGAGTCCATTCGTGATCACATCAACGAGAATGCCGACAAACCGGATATACCTCGA
GCAGTTCCACGCTTCGATCGACCTGAGGCTGATACGGAGAAACTGATGTGGATTCATGTGCCATATACGCATACT
GGCTGGGTATCCCAAGTCATTCGCCGAGCATGTGAGGATAGGCAAGAGCCTAATTTTGTTCGGAAATTTATCAAT
GACGAAAATTGGTACAACCGGTTTAATAGAGCTCGTCACCTCGAGCCCCATGCACGTTTCGTCAAGCCCGCATGC
ATTCACTCCAGACAAATGGATATTTCAGAACGTCCTTCTAATCCTTCCAAGGATCCTCAGCTCGCTCTATATGTT
CCCTACCTCCACTGGGATACATATCGCAACCTAATCCAACGGCGTAAGGTGGTCGAAGATCGACTCAACCAGGGC
CGATCCAAGCCCGTCCCAAGCCGGATCTCAAAGGCAAGCCTGGAAGCCCAACTCATCTGGAGCTATCTCGGCTGC
GAACCTCCAGTACATTTCCGCCGCACATTGGATCAATATGGGTATCCCAATCTACGCTCGACTATCGCTCGTGAC
GACGACCAGATGCTTTGGAAGCGCACTCGCAGACCGGCGCGCATTGATGAGCAATTAAAAGAGTATCTGCAGTCT
GCACAGGATGATCCCGATAACGAGGATATTGGCGAGTTTCTAGATGGCAATGTCCTGATGGTTGATCAGCTCTGG
CTTTGGATTGTGGATCAAAAGACTGTTGTTACTTTCTTTCCGAATCAAGAGGCTGCGACCTCTGAGGGGAAGCTT
TTTGAACAGTCGAACTTGCATCGCAGCATTTATAATGAGTTGAATGGGGATCTCTCGCGTCGGTTTGAGACCGCC
GGTGACTTGGCTGCTCTTATCATGCTGCATGCTGTCACTGTTCTCCTGGATAAGACTCTCAATCATGATCTGCAG
GTATTGCGAATCTTCGAGGAGTCAATCAGCATATTGACCGAATCAGTGACGAAGTCTTTCAAGCGCTTTCGAAAT
AGAGGCTTCACCAACCGCCCAGCGGATCATGACCGCACCTCAGACGGCAAGATCATGACAGCCGCGCAGCAAGAT
TACAAAGAATTGCAGGTTGCTCGTCGAAATCGAGAAGATCTATCCGTTCTGCTTGAGCTGCGTGACATCGAAGAC
GAGCTATCCACCATCCTAAAGCTGCTCGATCAACAAGACACCGTTATCAAAAATATGGTGAAATACTTCGGTAAC
AAAGGGTGCGGTAAATCATTCCTCGATACAGCACAAGAGCGAATCGACGAATATCGTTCACAAATCAATGAGATG
AAAGAAAACAGCCATCTAGCGCAGAAAGCAGTGGAAACGCTCCTTGACCTCAAGCAGAAACAGGCAAATGTCGAC
GAAGCCAAGATGACTCGGTGGCAAGCTGAAGTTGCCCAAACGCAATCGCGAGCAGTGATGGTCTTCACCATATTC
AGTGTTGTCTTCCTCCCTCTATCTTTCTTTACCTCCTTGTTTGGAATCAATGCCCGAGAATGGAGCGGGGAACAG
GCAAACCCAACCCTAGGACAAATGTTCGAAATAGCAGCCCCGGCATCCTTTGCAATAATCTTCCTGTCCCTCTTC
ATAGCCTTCAGCGAAACGCTACGCGATATCGTATCCAAAATGCACAAGATCGGCGCGGGCCTATCGAAGGACTTC
ATCCTGCATCCGATTAAATCATTCTTATGGGGTTCTGCTACAGGTAAAATACCTATTCACGTCGTGCCTGAGGAC
TCTGGGCTTAGGAAACGCTTTGATGAGTATCTGGGTTATGGGAGGCGGAATATGCAGCGTGATGAGGATATCTGG
CGGCGGTGGCAGGGGGATCGAATTTCTGCGGGGAAGGGAAACAAGAAGGGGAAGTATGAGATAAATTCTGGATTT
GATCGGAGACGCCCCGGGGAGGTTTAG
Gene >Pro_DTO377G3_2|g8008.t1
ATGCCTTCGCGGCCACCCGTGAACGACCAGACGCGCTCGTGGTTTGAGCCTGTTTCTCTCCATGACGATACTGAT
GTCGAGTAAGTTATTCCATCTTATCATACCATCATATAATAACTCATCCCTCAGTATTGTCGCTGTCCCGCCCGT
CGGCGCCCATCATAGAGAGACGTGGATAGCGCCTGGCGCGAAATTATCCTGGCTTGATGAAGAGCTACTACAGCA
TGTGCCTCGAGCACGAGTCCTACTATATAACTATGGAGACCTACGTGACGACAAAATCGATACCTTGGGTCAACG
ACTGTTGAACCAACTCCATAGTGAGTGGACACATGAGGTTAGTCACATGTCATCGTCTTTTCATATCCAAGAGTA
ATTTAATAAACATTTCCCTAGTCAACTCGACGTCCCATTTTTTTTATTTGCCACAGCACCGGTGGTCTCGTCGTC
AAAGCAGCTCTGGCCATGGCATCACGAGAGGCGAGCCAGTCGACCTTAATCAACTGTCATGGTATCGCCTTCTTT
GCAACTCCCCATCAAGGCTCGACCTATCTCTCTGCCGATGAATACGCGGCTAGTATACGTCGACTCCTGCATCTG
GATTGTGAGACCCCGGCAGCGCTCAGGATGCAGTTGCGTCCCCGTCAAGAGCACCTATGGCATCTGTCGAACCAG
TTCAAAACCCTTTCGGCTGACATGAGGGTCTGGTCTTTTCTCGAAACTGTGGATTCAACTATGCAGGTGATCGAC
ACCGAGACTCATAACATAATGGAGTTTCATGTGCCCATTACTTCGATTCGGTCGGGTTTGTTGGATATTGAGCAT
GAAAAAGAAGTGCCCATGGCAACGGACCATGCGGGGACGGCAACTTTCCATGGCCAGGAGTCTACACGAGATCGA
TTCCTCGATGAGCTTGCTAATGCTGTGGCCACGGCTGTTGAAATTTCCCAGCGCGAGGATATTCCGTTACGCGTG
GAAGAGCAAGTCAAGGTTCAAATTAACGGCTTCTTCGAGGATACTGCACTGGGTGTCAGTGACGAAAGTCCGCTC
AAGCTGTGGTCAACCAAAGTGTCCCTGAGAGAGTACATCTCTCGGGGTCCGTCAGCTTGTCTTCGGGAGAGACTA
GTTCGATTCCGACCCAGTGGCTTGGACCATTCACCAATGGGCAGTTATGGTAGATCTAGACCCGGTTCATCCTAC
GTTTCTCCTGGCTCCGATCCACACCATCCTCAAAGCCATCATGATGAGAAATCAAGGTTCCTGCAAGCCCCTATA
CCCTACAGGCCAATCTTTGAAGATCCATCCGATCCCTCTCCGAATATCCACATCACCGAAGCAGACATGGAGGGC
TACTCGAGCGACGCACCCAATGAAAGCCCATATCCGCCACAGGAACTAAAACGAAAGAGCTCAATCACCAAGCTG
GTGGAATTAATTCGACCTAAGCAATCCCACAGTCGAAGTGCTTCTGACAGCTCCCGGACAAATATTGAACAGCCA
CATTCGTAAGTAAACCACTGAGGCTTGCCGAAAACCAACAAATGTAAGCTAATAGATAACAGGACCTATTCTGCA
TCACAACCAGTGCAATCCTCTTTCCTGGCAGTACCCGAGTCCATTCGTGATCACATCAACGAGAATGCCGACAAA
CCGGATATACCTCGAGCAGTTCCACGCTTCGATCGACCTGAGGCTGATACGGAGAAACTGATGTGGATTCATGTG
CCATATACGCATACTGGCTGGGTATCCCAAGTCATTCGCCGAGCATGTGAGGATAGGCAAGAGCCTAATTTGTAG
GGCATATGAACTAACTCCACGGTTCTGCACATTGCTAACTATCTTTTGCAGTGTTCGGAAATTTATCAATGACGA
AAATTGGTACAACCGGTTTAATAGAGCTCGTCACCTCGAGCCCCATGCACGTTTCGTCAAGCCCGCATGCATTCA
CTCCAGACAAATGGATATTTCAGAACGTCCTTCTAATCCTTCCAAGGATCCTCAGCTCGCTCTATATGTATGTTT
CAAGTCCTCGATGTGAATATCAGCACTAACATATATATTTGTCAGGTTCCCTACGTTAGTACTTTCAATTGACCC
AGTACCCTTCTTCCGCACTGTACTAACTCACTCCAGCTCCACTGGGATACATATCGCAACCTAATCCAACGGCGT
AAGGTGGTCGAAGATCGACTCAACCAGGGCCGATCCAAGCCCGTCCCAAGCCGGATCTCAAAGGCAAGCCTGGAA
GCCCAACTCATCTGGAGCTATCTCGGCTGCGAACCTCCAGTACATTTCCGCCGCACATTGGATCAATATGGGTAT
CCCAATCTACGCTCGACTATCGCTCGTGACGACGACCAGATGCTTTGGAAGCGCACTCGCAGACCGGCGCGCATT
GATGAGCAATTAAAAGAGTATCTGCAGTCTGCACAGGATGATCCCGATAACGAGGATATTGGCGAGTTTCTAGAT
GGCAATGTCCTGATGGTTGATCAGCTCTGGCTTTGGATTGTGGATCAAAAGACTGTTGTTACTTTCTTTCCGAAT
CAAGAGGCTGCGACCTCTGAGGGGAAGCTTTTTGAACAGTCGAACTTGCATCGCAGCATTTATAATGAGTTGAAT
GGGGATCTCTCGCGTCGGTTTGAGACCGCCGGTGACTTGGCTGCTCTTATCATGCTGCATGCTGTCACTGTTCTC
CTGGATAAGACTCTCAATCATGATCTGCAGGTATTGCGAATCTTCGAGGAGTCAATCAGCATATTGGTAGGTTCA
TCCCTTCGTGACAACTCCTTGGGTAGATCATATTAACAAAATCAGACCGAATCAGTGACGAAGTCTTTCAAGCGC
TTTCGAAATAGAGGCTTCACCAACCGCCCAGCGGATCATGACCGCACCTCAGACGGCAAGATCATGACAGCCGCG
CAGCAAGATTACAAAGAATTGCAGGTTGCTCGTCGAAATCGAGAAGATCTATCCGTTCTGCTTGAGCTGCGTGAC
ATCGAAGACGAGCTATCCACCATCCTAAAGCTGCTCGATCAACAAGACACCGTTATCAAAAATATGGTGAAATAC
TTCGGTAACAAAGGGTGCGGTAAATCATTCCTCGATACAGCACAAGAGCGAATCGACGAATATCGTTCACAAATC
AATGAGATGAAAGAAAACAGCCATCTAGCGCAGAAAGCAGTGAGTTCCCACGTTCCCCGTTCACGTCTTTTTTTT
TCCTACTAACCAGCCAGGTGGAAACGCTCCTTGACCTCAAGCAGAAACAGGCAAATGTCGACGAAGCCAAGATGA
CTCGGTGGCAAGCTGAAGTTGCCCAAACGCAATCGCGAGCAGTGATGGTCTTCACCATATTCAGTGTTGTGTAAG
TCTACATACTCTCCAAAATCCAAGAATCAGTTCTGACAATTCAAGCTTCCTCCCTCTATCTTTCTTTACCTCCTT
GTTTGGAATCAATGCCCGAGAATGGAGCGGGGAACAGGCAAACCCAACCCTAGGACAAATGTTCGAAATAGCAGG
TCCGTTTCGTCTCAAACACTATATGACTATACCAACTGACATTTTCCAGCCCCGGCATCCTTTGCAATAATCTTC
CTGTCCCTCTTCATAGCCTTCAGCGAAACGCTACGCGATATCGTATCCAAAATGCACAAGATCGGCGCGGGCCTA
TCGAAGGACTTCATCCTGCATCCGATTAAATCATTCTTATGGGGTTCTGCTACAGGTAAAATACCTATTCACGTC
GTGCCTGAGGACTCTGGGCTTAGGAAACGCTTTGATGAGTATCTGGGTTATGGGAGGCGGAATATGCAGCGTGAT
GAGGATATCTGGCGGCGGTGGCAGGGGGATCGAATTTCTGCGGGGAAGGGAAACAAGAAGGGGAAGTATGAGATA
AATTCTGGATTTGATCGGAGACGCCCCGGGGAGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail