Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7986.t1
Gene name
Locationscaffold_28:53388..56825
Strand-
Gene length (bp)3437
Transcript length (bp)3276
Coding sequence length (bp)3276
Protein length (aa) 1092

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11923 NFACT-C NFACT protein C-terminal domain 2.5E-41 940 1055
PF05833 NFACT_N NFACT N-terminal and middle domains 4.5E-34 7 510
PF05670 NFACT-R_1 NFACT protein RNA binding domain 3.3E-29 547 661

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7986.t1
MKQRFSSLDVKVITQELASECVNLRVSNIYDLSSRIFLFKLAKPDHRRQLIIDSGFRTHVTQYSRTAASTPSPFV
TRLRKYLKSRRITGITQIGTDRIIDFSFSDGAYHIFLEFFAGGNIILTDREYNIIAFFRQVAAGVGQEEIKAGLK
YTVSNKQNYDGVPDITANRVLQTLEKAQGLSAQEENAPKKFKKKGTDVLRKALSQGFPEYPPLLLDHVFAIKEFD
TTTPLDQVLGSPDLLQTVKEVLEEARRISNSFDSGGSHPGYIVAKEDTRPIPEGETSSKAPGLLYEDFHPFKPRQ
FENKPGIKILEFERFNATVDEYFSSLESQRLESRLTEREEAAKKKLESVRSEHKKRIDELKTVQELHIRKADAIQ
DNVYRVQEAMDAVNGLVAQGMDWGEIARLIEMEQDRGNPVAQTIKLPLKLYENTITLLLGEAGDDEDEDEEFSSS
DESDSDSDNEAEQETGRAERESNLLTIDIDLSLSPWANASQYYDQKKQASEKEQRTTQSSTKALKSHEKKVTTDL
KRGLKKEKQVLRQARTPFWFEKFIFFISSEGYLVIGARDAMQSELIYRRYLSKGDIFVHADLEGATPIVVKNRAG
SADAPISPSTLSQAGNLCVATSTAWDSKAVMSAWWAHAHQVSKIAENGSGIMPTGVFQIKGEKNFLAPSQLVLGF
GIMFQVSQESVRNHKQRFETPDIPNAAINPADETEASEPKETLEPEASGQTEATEEATEDAEKEDAESEEEDEDE
KAATRNPLQRGNSELSVSQPTQELASESESEPEEEPKDELEKEVGEVQGEEATPAAGQNSVPEKSEERNLNNREQ
RASGQGKLLGQEQPAPRITPTRGKRAKDKRAAAKYAHQDDDERELALRLVGANKGKAAKAAKAAEAKEQREREAE
AQRQRRRAQHERAAEAERKRQAQFTENGTDDYNEETAAAEAADLTWIPALVGTPTIDDQIIAAIPVCAPWAALGR
YKYKVKLQPGSVKKGKAVKEIVGRWVSETTTGKVKKEHAEDVGISRVDAERLREREGELIKGWKDTEIINTMVVG
KVRIMTAGAGSGGGGDKGKGKGGKGGGGGGGGRGGGKGKKK*
Coding >Pro_DTO377G3_2|g7986.t1
ATGAAGCAGAGATTCTCATCTTTAGACGTCAAGGTCATCACCCAGGAATTGGCGTCGGAGTGTGTCAACCTCCGA
GTGTCCAACATCTACGACCTGTCCTCGCGTATATTTCTTTTCAAACTCGCCAAGCCGGACCATCGACGCCAACTC
ATTATTGACTCCGGTTTTCGTACTCATGTCACTCAATATTCGCGGACCGCGGCATCCACACCATCGCCCTTTGTG
ACCCGTCTCCGAAAGTACCTGAAGTCTCGTCGGATTACAGGCATCACCCAAATCGGAACTGATCGCATCATCGAC
TTCTCTTTTAGCGATGGCGCATACCATATCTTCCTTGAATTCTTCGCCGGCGGTAACATTATCTTGACGGACCGC
GAATACAACATTATTGCTTTCTTTCGCCAAGTTGCCGCCGGTGTTGGTCAGGAAGAGATAAAGGCCGGACTCAAG
TACACTGTATCTAATAAACAGAACTATGATGGGGTTCCAGACATCACAGCGAATCGGGTTTTGCAAACACTGGAA
AAGGCACAGGGGCTTTCTGCCCAAGAGGAAAATGCACCAAAAAAGTTCAAGAAAAAGGGAACGGATGTTTTGCGC
AAGGCATTGTCGCAAGGCTTTCCTGAATACCCTCCCTTGCTTCTAGACCACGTCTTTGCGATCAAGGAATTCGAT
ACTACAACGCCACTGGATCAAGTCTTGGGGAGCCCAGATCTGTTGCAGACTGTGAAAGAAGTGCTAGAGGAAGCG
CGTCGAATTTCTAACAGCTTTGATTCTGGTGGCAGCCATCCAGGCTACATTGTTGCGAAAGAAGACACGCGACCC
ATCCCGGAAGGAGAGACATCGTCAAAGGCCCCGGGTCTGCTCTACGAAGACTTCCACCCTTTTAAACCTCGACAG
TTTGAAAACAAACCAGGAATAAAGATCTTGGAGTTCGAGCGCTTCAATGCCACAGTCGACGAGTATTTTTCATCC
CTTGAATCTCAGCGTCTCGAGTCACGATTGACAGAGCGTGAAGAAGCAGCCAAGAAGAAGCTCGAATCTGTGCGA
TCAGAACACAAGAAGCGGATTGATGAGCTCAAGACCGTGCAAGAACTTCACATCCGTAAAGCGGATGCTATTCAG
GACAATGTTTACCGAGTCCAGGAGGCAATGGATGCTGTCAATGGGCTCGTGGCTCAGGGAATGGACTGGGGTGAA
ATTGCGCGCCTGATCGAGATGGAACAAGATCGCGGCAATCCAGTGGCGCAAACCATTAAGTTGCCCCTCAAACTG
TACGAAAACACGATCACTTTACTTCTTGGAGAGGCCGGTGACGATGAGGATGAAGACGAGGAGTTTTCTAGCAGT
GATGAATCAGACTCCGACTCAGATAACGAAGCAGAACAAGAGACAGGTCGTGCGGAACGAGAGTCAAATCTATTG
ACCATTGACATTGACCTTAGTCTGAGCCCATGGGCGAACGCATCGCAGTATTATGACCAGAAGAAGCAAGCTTCG
GAGAAGGAGCAAAGGACAACGCAGTCGTCTACGAAGGCACTGAAGAGTCATGAGAAGAAGGTGACGACCGACCTG
AAGCGAGGCTTGAAGAAAGAAAAGCAAGTTCTTCGACAGGCTCGGACGCCATTCTGGTTCGAGAAATTTATCTTT
TTCATCTCTTCGGAGGGTTACTTGGTCATAGGTGCACGTGATGCTATGCAGAGCGAATTGATCTACCGTCGTTAC
TTGTCTAAGGGCGATATATTTGTGCACGCTGACCTCGAAGGCGCGACGCCAATCGTGGTAAAGAACCGAGCGGGC
AGTGCAGACGCACCAATCTCTCCAAGCACACTATCTCAAGCCGGCAACCTTTGCGTTGCTACTTCCACTGCTTGG
GATTCTAAGGCTGTCATGTCTGCTTGGTGGGCGCATGCTCATCAGGTATCGAAAATCGCCGAGAATGGCAGCGGA
ATCATGCCCACGGGTGTCTTTCAAATCAAGGGAGAGAAGAACTTCTTGGCCCCATCGCAGCTGGTACTTGGATTT
GGTATTATGTTTCAAGTCAGTCAGGAAAGCGTTCGGAACCATAAGCAGCGATTTGAAACACCTGACATTCCAAAC
GCCGCTATAAATCCTGCGGATGAGACTGAGGCTTCTGAGCCGAAGGAAACTCTGGAGCCAGAAGCCTCGGGGCAG
ACAGAGGCCACCGAAGAAGCTACCGAAGACGCAGAGAAGGAAGATGCGGAATCTGAAGAGGAAGACGAAGATGAG
AAAGCCGCTACTAGAAACCCTCTCCAACGAGGCAATTCCGAGCTCTCGGTCTCTCAGCCAACTCAAGAATTGGCG
TCTGAGTCTGAGTCTGAGCCGGAAGAAGAACCGAAGGATGAGCTGGAAAAAGAAGTCGGAGAAGTTCAGGGAGAA
GAAGCTACACCAGCAGCAGGTCAAAATTCTGTGCCCGAGAAAAGTGAAGAACGGAATTTGAACAATCGAGAGCAA
CGTGCCTCGGGACAAGGCAAGCTTCTTGGCCAGGAACAACCTGCACCACGCATCACCCCCACTCGCGGTAAGCGA
GCGAAGGACAAGCGCGCTGCTGCCAAGTATGCTCATCAAGACGATGATGAGCGAGAACTTGCTCTTCGGTTGGTG
GGTGCCAATAAGGGCAAAGCTGCAAAGGCGGCCAAGGCAGCTGAAGCTAAGGAACAGCGTGAACGAGAGGCTGAG
GCGCAGAGGCAACGACGACGGGCCCAGCACGAGCGTGCTGCCGAAGCCGAGCGCAAACGCCAAGCCCAGTTTACA
GAAAATGGAACGGACGATTACAACGAGGAGACAGCTGCCGCCGAGGCTGCGGATCTCACATGGATTCCAGCATTG
GTGGGTACACCAACTATAGACGACCAAATAATTGCTGCTATTCCTGTATGTGCCCCGTGGGCTGCCCTTGGACGC
TACAAATACAAAGTCAAGCTACAGCCGGGCTCCGTGAAGAAGGGGAAGGCCGTCAAGGAGATCGTTGGTCGGTGG
GTGTCCGAGACCACCACCGGGAAGGTCAAGAAGGAGCATGCCGAAGATGTCGGGATCTCTCGTGTCGATGCTGAG
CGTCTTCGGGAACGGGAAGGAGAGCTCATCAAGGGCTGGAAGGATACGGAGATTATCAACACTATGGTTGTGGGC
AAGGTGCGCATCATGACTGCAGGAGCTGGAAGCGGCGGCGGTGGTGATAAGGGCAAGGGCAAAGGTGGAAAGGGT
GGAGGTGGGGGTGGAGGTGGCAGAGGAGGTGGTAAGGGCAAGAAGAAATGA
Transcript >Pro_DTO377G3_2|g7986.t1
ATGAAGCAGAGATTCTCATCTTTAGACGTCAAGGTCATCACCCAGGAATTGGCGTCGGAGTGTGTCAACCTCCGA
GTGTCCAACATCTACGACCTGTCCTCGCGTATATTTCTTTTCAAACTCGCCAAGCCGGACCATCGACGCCAACTC
ATTATTGACTCCGGTTTTCGTACTCATGTCACTCAATATTCGCGGACCGCGGCATCCACACCATCGCCCTTTGTG
ACCCGTCTCCGAAAGTACCTGAAGTCTCGTCGGATTACAGGCATCACCCAAATCGGAACTGATCGCATCATCGAC
TTCTCTTTTAGCGATGGCGCATACCATATCTTCCTTGAATTCTTCGCCGGCGGTAACATTATCTTGACGGACCGC
GAATACAACATTATTGCTTTCTTTCGCCAAGTTGCCGCCGGTGTTGGTCAGGAAGAGATAAAGGCCGGACTCAAG
TACACTGTATCTAATAAACAGAACTATGATGGGGTTCCAGACATCACAGCGAATCGGGTTTTGCAAACACTGGAA
AAGGCACAGGGGCTTTCTGCCCAAGAGGAAAATGCACCAAAAAAGTTCAAGAAAAAGGGAACGGATGTTTTGCGC
AAGGCATTGTCGCAAGGCTTTCCTGAATACCCTCCCTTGCTTCTAGACCACGTCTTTGCGATCAAGGAATTCGAT
ACTACAACGCCACTGGATCAAGTCTTGGGGAGCCCAGATCTGTTGCAGACTGTGAAAGAAGTGCTAGAGGAAGCG
CGTCGAATTTCTAACAGCTTTGATTCTGGTGGCAGCCATCCAGGCTACATTGTTGCGAAAGAAGACACGCGACCC
ATCCCGGAAGGAGAGACATCGTCAAAGGCCCCGGGTCTGCTCTACGAAGACTTCCACCCTTTTAAACCTCGACAG
TTTGAAAACAAACCAGGAATAAAGATCTTGGAGTTCGAGCGCTTCAATGCCACAGTCGACGAGTATTTTTCATCC
CTTGAATCTCAGCGTCTCGAGTCACGATTGACAGAGCGTGAAGAAGCAGCCAAGAAGAAGCTCGAATCTGTGCGA
TCAGAACACAAGAAGCGGATTGATGAGCTCAAGACCGTGCAAGAACTTCACATCCGTAAAGCGGATGCTATTCAG
GACAATGTTTACCGAGTCCAGGAGGCAATGGATGCTGTCAATGGGCTCGTGGCTCAGGGAATGGACTGGGGTGAA
ATTGCGCGCCTGATCGAGATGGAACAAGATCGCGGCAATCCAGTGGCGCAAACCATTAAGTTGCCCCTCAAACTG
TACGAAAACACGATCACTTTACTTCTTGGAGAGGCCGGTGACGATGAGGATGAAGACGAGGAGTTTTCTAGCAGT
GATGAATCAGACTCCGACTCAGATAACGAAGCAGAACAAGAGACAGGTCGTGCGGAACGAGAGTCAAATCTATTG
ACCATTGACATTGACCTTAGTCTGAGCCCATGGGCGAACGCATCGCAGTATTATGACCAGAAGAAGCAAGCTTCG
GAGAAGGAGCAAAGGACAACGCAGTCGTCTACGAAGGCACTGAAGAGTCATGAGAAGAAGGTGACGACCGACCTG
AAGCGAGGCTTGAAGAAAGAAAAGCAAGTTCTTCGACAGGCTCGGACGCCATTCTGGTTCGAGAAATTTATCTTT
TTCATCTCTTCGGAGGGTTACTTGGTCATAGGTGCACGTGATGCTATGCAGAGCGAATTGATCTACCGTCGTTAC
TTGTCTAAGGGCGATATATTTGTGCACGCTGACCTCGAAGGCGCGACGCCAATCGTGGTAAAGAACCGAGCGGGC
AGTGCAGACGCACCAATCTCTCCAAGCACACTATCTCAAGCCGGCAACCTTTGCGTTGCTACTTCCACTGCTTGG
GATTCTAAGGCTGTCATGTCTGCTTGGTGGGCGCATGCTCATCAGGTATCGAAAATCGCCGAGAATGGCAGCGGA
ATCATGCCCACGGGTGTCTTTCAAATCAAGGGAGAGAAGAACTTCTTGGCCCCATCGCAGCTGGTACTTGGATTT
GGTATTATGTTTCAAGTCAGTCAGGAAAGCGTTCGGAACCATAAGCAGCGATTTGAAACACCTGACATTCCAAAC
GCCGCTATAAATCCTGCGGATGAGACTGAGGCTTCTGAGCCGAAGGAAACTCTGGAGCCAGAAGCCTCGGGGCAG
ACAGAGGCCACCGAAGAAGCTACCGAAGACGCAGAGAAGGAAGATGCGGAATCTGAAGAGGAAGACGAAGATGAG
AAAGCCGCTACTAGAAACCCTCTCCAACGAGGCAATTCCGAGCTCTCGGTCTCTCAGCCAACTCAAGAATTGGCG
TCTGAGTCTGAGTCTGAGCCGGAAGAAGAACCGAAGGATGAGCTGGAAAAAGAAGTCGGAGAAGTTCAGGGAGAA
GAAGCTACACCAGCAGCAGGTCAAAATTCTGTGCCCGAGAAAAGTGAAGAACGGAATTTGAACAATCGAGAGCAA
CGTGCCTCGGGACAAGGCAAGCTTCTTGGCCAGGAACAACCTGCACCACGCATCACCCCCACTCGCGGTAAGCGA
GCGAAGGACAAGCGCGCTGCTGCCAAGTATGCTCATCAAGACGATGATGAGCGAGAACTTGCTCTTCGGTTGGTG
GGTGCCAATAAGGGCAAAGCTGCAAAGGCGGCCAAGGCAGCTGAAGCTAAGGAACAGCGTGAACGAGAGGCTGAG
GCGCAGAGGCAACGACGACGGGCCCAGCACGAGCGTGCTGCCGAAGCCGAGCGCAAACGCCAAGCCCAGTTTACA
GAAAATGGAACGGACGATTACAACGAGGAGACAGCTGCCGCCGAGGCTGCGGATCTCACATGGATTCCAGCATTG
GTGGGTACACCAACTATAGACGACCAAATAATTGCTGCTATTCCTGTATGTGCCCCGTGGGCTGCCCTTGGACGC
TACAAATACAAAGTCAAGCTACAGCCGGGCTCCGTGAAGAAGGGGAAGGCCGTCAAGGAGATCGTTGGTCGGTGG
GTGTCCGAGACCACCACCGGGAAGGTCAAGAAGGAGCATGCCGAAGATGTCGGGATCTCTCGTGTCGATGCTGAG
CGTCTTCGGGAACGGGAAGGAGAGCTCATCAAGGGCTGGAAGGATACGGAGATTATCAACACTATGGTTGTGGGC
AAGGTGCGCATCATGACTGCAGGAGCTGGAAGCGGCGGCGGTGGTGATAAGGGCAAGGGCAAAGGTGGAAAGGGT
GGAGGTGGGGGTGGAGGTGGCAGAGGAGGTGGTAAGGGCAAGAAGAAATGA
Gene >Pro_DTO377G3_2|g7986.t1
ATGAAGCAGAGATTCTCATCTTTAGACGTCAAGGTATCTTCAAATATGTGTCGAAGAAGATATCACACTAACAAC
CCCAGGTCATCACCCAGGAATTGGCGTCGGAGTGTGTCAACCTCCGAGTGTCCAACATCTACGACCTGTCCTCGG
TACGCTCAATTCTTTTCTCTATTACCATGGAAGGACGGCGAGCTGATTATTTATTCCTATTAGCGTATATTTCTT
TTCAAACTCGCCAAGCCGGACCATCGACGCCAACTCATTATTGACTCCGGTTTTCGTACTCATGTCACTCAATAT
TCGCGGACCGCGGCATCCACACCATCGCCCTTTGTGACCCGTCTCCGAAAGTACCTGAAGTCTCGTCGGATTACA
GGCATCACCCAAATCGGAACTGATCGCATCATCGACTTCTCTTTTAGCGATGGCGCATACCATATCTTCCTTGAA
TTCTTCGCCGGCGGTAACATTATCTTGACGGACCGCGAATACAACATTATTGCTTTCTTTCGCCAAGTTGCCGCC
GGTGTTGGTCAGGAAGAGATAAAGGCCGGACTCAAGTACACTGTATCTAATAAACAGAACTATGATGGGGTTCCA
GACATCACAGCGAATCGGGTTTTGCAAACACTGGAAAAGGCACAGGGGCTTTCTGCCCAAGAGGAAAATGCACCA
AAAAAGTTCAAGAAAAAGGGAACGGATGTTTTGCGCAAGGCATTGTCGCAAGGCTTTCCTGAATACCCTCCCTTG
CTTCTAGACCACGTCTTTGCGATCAAGGAATTCGATACTACAACGCCACTGGATCAAGTCTTGGGGAGCCCAGAT
CTGTTGCAGACTGTGAAAGAAGTGCTAGAGGAAGCGCGTCGAATTTCTAACAGCTTTGATTCTGGTGGCAGCCAT
CCAGGCTACATTGTTGCGAAAGAAGACACGCGACCCATCCCGGAAGGAGAGACATCGTCAAAGGCCCCGGGTCTG
CTCTACGAAGACTTCCACCCTTTTAAACCTCGACAGTTTGAAAACAAACCAGGAATAAAGATCTTGGAGTTCGAG
CGCTTCAATGCCACAGTCGACGAGTATTTTTCATCCCTTGAATCTCAGCGTCTCGAGTCACGATTGACAGAGCGT
GAAGAAGCAGCCAAGAAGAAGCTCGAATCTGTGCGATCAGAACACAAGAAGCGGATTGATGAGCTCAAGACCGTG
CAAGAACTTCACATCCGTAAAGCGGATGCTATTCAGGACAATGTTTACCGAGTCCAGGAGGCAATGGATGCTGTC
AATGGGCTCGTGGCTCAGGGAATGGACTGGGGTGAAATTGCGCGCCTGATCGAGATGGAACAAGATCGCGGCAAT
CCAGTGGCGCAAACCATTAAGTTGCCCCTCAAACTGTACGAAAACACGATCACTTTACTTCTTGGAGAGGCCGGT
GACGATGAGGATGAAGACGAGGAGTTTTCTAGCAGTGATGAATCAGACTCCGACTCAGATAACGAAGCAGAACAA
GAGACAGGTCGTGCGGAACGAGAGTCAAATCTATTGACCATTGACATTGACCTTAGTCTGAGCCCATGGGCGAAC
GCATCGCAGTATTATGACCAGAAGAAGCAAGCTTCGGAGAAGGAGCAAAGGACAACGCAGTCGTCTACGAAGGCA
CTGAAGAGTCATGAGAAGAAGGTGACGACCGACCTGAAGCGAGGCTTGAAGAAAGAAAAGCAAGTTCTTCGACAG
GCTCGGACGCCATTCTGGTTCGAGAAATTTATCTTTTTCATCTCTTCGGAGGGTTACTTGGTCATAGGGTATGTG
GCTCTATTCAACACCGTTTTATGAAATCTACTAATCCTAGTAGTGCACGTGATGCTATGCAGAGCGAATTGATCT
ACCGTCGTTACTTGTCTAAGGGCGATATATTTGTGCACGCTGACCTCGAAGGCGCGACGCCAATCGTGGTAAAGA
ACCGAGCGGGCAGTGCAGACGCACCAATCTCTCCAAGCACACTATCTCAAGCCGGCAACCTTTGCGTTGCTACTT
CCACTGCTTGGGATTCTAAGGCTGTCATGTCTGCTTGGTGGGCGCATGCTCATCAGGTATCGAAAATCGCCGAGA
ATGGCAGCGGAATCATGCCCACGGGTGTCTTTCAAATCAAGGGAGAGAAGAACTTCTTGGCCCCATCGCAGCTGG
TACTTGGATTTGGTATTATGTTTCAAGTCAGTCAGGAAAGCGTTCGGAACCATAAGCAGCGATTTGAAACACCTG
ACATTCCAAACGCCGCTATAAATCCTGCGGATGAGACTGAGGCTTCTGAGCCGAAGGAAACTCTGGAGCCAGAAG
CCTCGGGGCAGACAGAGGCCACCGAAGAAGCTACCGAAGACGCAGAGAAGGAAGATGCGGAATCTGAAGAGGAAG
ACGAAGATGAGAAAGCCGCTACTAGAAACCCTCTCCAACGAGGCAATTCCGAGCTCTCGGTCTCTCAGCCAACTC
AAGAATTGGCGTCTGAGTCTGAGTCTGAGCCGGAAGAAGAACCGAAGGATGAGCTGGAAAAAGAAGTCGGAGAAG
TTCAGGGAGAAGAAGCTACACCAGCAGCAGGTCAAAATTCTGTGCCCGAGAAAAGTGAAGAACGGAATTTGAACA
ATCGAGAGCAACGTGCCTCGGGACAAGGCAAGCTTCTTGGCCAGGAACAACCTGCACCACGCATCACCCCCACTC
GCGGTAAGCGAGCGAAGGACAAGCGCGCTGCTGCCAAGTATGCTCATCAAGACGATGATGAGCGAGAACTTGCTC
TTCGGTTGGTGGGTGCCAATAAGGGCAAAGCTGCAAAGGCGGCCAAGGCAGCTGAAGCTAAGGAACAGCGTGAAC
GAGAGGCTGAGGCGCAGAGGCAACGACGACGGGCCCAGCACGAGCGTGCTGCCGAAGCCGAGCGCAAACGCCAAG
CCCAGTTTACAGAAAATGGAACGGACGATTACAACGAGGAGACAGCTGCCGCCGAGGCTGCGGATCTCACATGGA
TTCCAGCATTGGTGGGTACACCAACTATAGACGACCAAATAATTGCTGCTATTCCTGTATGTGCCCCGTGGGCTG
CCCTTGGACGCTACAAATACAAAGTCAAGCTACAGCCGGGCTCCGTGAAGAAGGGGAAGGCCGTCAAGGAGATCG
TTGGTCGGTGGGTGTCCGAGACCACCACCGGGAAGGTCAAGAAGGAGCATGCCGAAGATGTCGGGATCTCTCGTG
TCGATGCTGAGCGTCTTCGGGAACGGGAAGGAGAGCTCATCAAGGGCTGGAAGGATACGGAGATTATCAACACTA
TGGTTGTGGGCAAGGTGCGCATCATGACTGCAGGAGCTGGAAGCGGCGGCGGTGGTGATAAGGGCAAGGGCAAAG
GTGGAAAGGGTGGAGGTGGGGGTGGAGGTGGCAGAGGAGGTGGTAAGGGCAAGAAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail