Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7981.t1
Gene name
Locationscaffold_28:40296..46988
Strand+
Gene length (bp)6692
Transcript length (bp)6198
Coding sequence length (bp)6198
Protein length (aa) 2066

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 1.8E-17 1114 1261
PF00145 DNA_methylase C-5 cytosine-specific DNA methylase 6.9E-12 102 485

GO

GO Term Description Terminal node
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0005524 ATP binding Yes
GO:0008168 methyltransferase activity Yes
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 22.45 13.68 31.22
5d_25C Five days - 25 degrees Celsius 43.54 25.35 61.72
7d_25C Seven days - 25 degrees Celsius 49.17 28.54 69.81
10d_25C Ten days - 25 degrees Celsius 74.79 43.18 106.41
7d_15C Seven days - 15 degrees Celsius 72.82 38.85 106.78
7d_30C Seven days - 30 degrees Celsius 40.00 22.93 57.08

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.004840 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.681766 no
5d_25C 7d_15C 0.023923 yes
5d_25C 7d_30C 0.789183 no
5d_25C 10d_25C 0.011388 yes
7d_25C 7d_15C 0.107863 no
7d_25C 7d_30C 0.444706 no
7d_25C 10d_25C 0.067273 no
7d_15C 7d_30C 0.009124 yes
7d_15C 10d_25C 0.944111 no
7d_30C 10d_25C 0.003625 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7981.t1
MVSKGISQQQSGDGLAMDDQESSAGADEIPELRRGRMIPSGRYLANNLPPLHTLREIFADMASKAMEIGLEQVLI
RLGSRPLRVATMCSGTEAPLLALELIQKGLPEAQQLRILHAFSCEIVPFKQSYIERNFRPPLLFRDITELGGDEA
RTAYGSLEAIPGNLDILVAGTACVDFSPLNNRQKTLQQGGESGATFDGLLRYAKRYRPRMIVQENVRNAPWEQMK
GKWEELRYMSVCVNVDTKHYYIPQTRERGYMVVIDKHRLEAAGLLGDTMDQSGIEIVTQRVRELADRFKRPASAP
VGLFLLSDDDRRLELIEMRARLESRSETSWDQYQIRHQRHRDELELGSERPITRSLPGINELKTPDFYWHRFWKT
QSERVWETVDMNFLKKMLQDYDMNFKERWIDLSQGVDRGNDSLAGSGIAGCLTPKGMPFVTTRGGPVSGTEALSL
QGLPLDRMLLTRETQADLMDMAGNAMTSTVVCAIMLAGLIAVHEILDDGEEFSTNSGEAEAKSLLVPSEAHSLVR
SNLQVVQTPLIDHAVLKVKAASSVLCCSCERQTRVQDSIYSCTLCGHTACKSCRGNPTHSYLHVSPLSRQKPSEF
IANLKALVPMKLMLSDLSDLGFEMFRSLYHITNLPRFWPDFIMCVKAAVHDVFRFFEIKRGRKWRVVYDGTHSSL
YLDIGPDSFQWLLYAKPPKSASRRSVIREVLAKPIARMSPTSGSLVEGTWEISSPISTPILLQISGRGHQVRSFQ
SECGIKAAKFVDGKVWDSIFVEGSDQNVAALDFDVRGMYQFLPDCGTALGALYRRKATAHAPRIFLFLDPAKIGP
ADEDAFVFALEHDRLPGYDVRMTIAELSSKWTSLNVTMDSQDVKAFCRRWAKAPKAHLNQCPAEQITLHTLQQGM
QVSIENQNCHDACITLTSLSATTSILNLPDANSDWQAWNPEVSMRELKGLAWLFPKIAAWSDFKDWNEIILPDCS
DLKHHANGNCNTCNPPTPSILWGRDNRDRIIPYENPQDAAVYERAIKNRPSPFLVFRRINEHGDAELRFTLNVQA
LTHQAHGKLFGTASHEGVTSFWRLLPHAYDMSQETPGIFTLRSNDNDSLSPQPPNFKFKLRDEQLRSLSWMITQE
AKEMEPFMEEEVEESILPLMPWRAEVKATMPKVVRGGVLADEVGYGKTAVILGLIDTQYESDCKPPEENGLISTK
ATLIIVPSNVFKQWVSETKKFLGGKYKVLAISSISKITIREVEDADIVILSWSILANDAYYSRLQQFTGTPQAPA
KSSGGTGRNFDSWFHNARASLRESVDILKTQGSEAMLRQLEARRRRVQETQANFTYVPSRRLRGQAFADAKNGRD
ECNAGEERNLDSESDSGFEDFGASDARQSPEAGQRKRRHSRKSVEGPRGKRQKHSLTELTEVTDDGKKLGAKSTA
VKDDRKDFDINKTAEHDWRTVKAAFIHAFNFNRLVIDEYTYAGEERQASLLSLQARSKWILSGTPALREFADIKS
VARYLGLHLGVDDDGDCDKPTQNSRLRNIRKNHTAVEAFQYYQAPHSNAWYQNRREHAQNFLDRFARQNIARITH
IPLKTTFVVTEQSPAEKTAYDTLLRAVKENKRRIPGPLSTILSKSQVPQEALIMSCVTNQIGQPPWNLEKCRKGS
QNDKKKSAEIWTKVDSITRQAAIVWYRELKNTDPNNWQKALNGVAKIDFGDAQLNKRFKQLLEDIIRSYSEWKLA
EQHQPIDDLLQQRFQKIQNSKTGNKATGKRPPRATEYGKPVDAFSNSVWIAVEKTLSADVTSLLKQVLEIDREYR
FYEHLVRIQTIGILLCQKCNGDLQEKEDVNVLKTCGHVLCKDCIAAGSRKPCPIIGCGGQIVQSKIVPGEILVSE
DQEIQSTKLNKLVEIVRNVPEEELVLIFVQINHLLPVVSNALKAANIDHRMVTQTNLKGIDEFTEAPKLKKGMTQ
PPSRPKALILNLGNSMAAGLNLQCANHVIFLSPYFAPSDHDFEAGMTQAVGRARRFGQEREVHVYHLLVKNTYEV
NIFQNAQSSKLVERQGVHVLVPEEEVLPNDIGCEGEEMPE*
Coding >Pro_DTO377G3_2|g7981.t1
ATGGTGTCAAAGGGAATTTCTCAGCAGCAGTCGGGGGATGGTTTGGCAATGGATGATCAGGAGTCTAGTGCCGGG
GCCGATGAGATTCCTGAGCTGCGGCGGGGACGCATGATCCCTTCGGGTCGGTATCTAGCCAATAACCTCCCCCCT
CTGCATACGCTGAGAGAAATTTTTGCTGACATGGCATCAAAGGCCATGGAAATTGGACTCGAGCAAGTCCTCATT
CGGCTCGGCAGTCGACCACTTCGAGTGGCGACAATGTGCTCAGGAACCGAAGCCCCGCTTCTAGCCCTGGAATTG
ATACAGAAGGGTTTGCCGGAGGCCCAGCAACTTCGGATCTTGCACGCTTTCAGCTGTGAGATTGTTCCATTCAAG
CAGTCGTACATTGAGCGAAACTTCCGCCCCCCTCTCCTCTTTCGGGACATCACCGAACTTGGAGGAGACGAGGCG
CGGACCGCCTACGGGTCATTAGAAGCAATTCCCGGTAACCTCGACATATTAGTTGCTGGAACTGCCTGTGTCGAC
TTCTCTCCTTTGAACAACCGCCAGAAGACGCTGCAGCAAGGCGGCGAGTCGGGAGCTACGTTCGACGGTCTCTTG
CGGTACGCGAAGAGATATCGACCCCGCATGATCGTTCAGGAGAATGTCCGGAATGCGCCCTGGGAGCAGATGAAG
GGGAAGTGGGAGGAGCTCAGGTACATGTCCGTTTGTGTCAATGTCGACACGAAGCATTACTACATCCCGCAGACA
CGCGAGCGCGGGTACATGGTGGTTATTGACAAGCACCGCTTGGAAGCAGCGGGCCTACTTGGAGACACCATGGAT
CAAAGTGGCATTGAAATTGTCACTCAACGCGTTCGTGAGCTAGCTGATCGTTTCAAACGGCCAGCGAGTGCACCG
GTGGGGTTGTTCTTGCTGAGTGATGACGATCGCCGACTCGAGCTCATCGAGATGAGAGCCCGCCTTGAGTCCCGA
AGCGAAACCAGCTGGGATCAGTACCAGATTCGTCACCAACGGCACCGTGACGAACTGGAACTAGGTAGCGAGAGG
CCAATCACTCGATCCCTTCCCGGGATCAATGAACTGAAGACACCGGACTTCTATTGGCATCGTTTCTGGAAGACA
CAGTCGGAGAGAGTGTGGGAGACCGTGGATATGAATTTCCTGAAGAAGATGCTTCAAGATTATGACATGAACTTC
AAGGAGCGTTGGATTGACTTATCTCAGGGCGTCGATCGAGGGAATGACAGCCTTGCCGGTTCTGGTATCGCAGGG
TGTCTGACACCGAAGGGCATGCCATTTGTGACAACCCGCGGCGGCCCCGTATCTGGCACGGAGGCTCTTTCGTTG
CAAGGACTGCCCCTCGATCGAATGTTACTCACGAGAGAAACCCAAGCCGATTTGATGGATATGGCAGGAAATGCA
ATGACGAGTACGGTAGTGTGTGCAATCATGCTGGCTGGTCTGATAGCCGTGCATGAGATTCTTGACGACGGCGAG
GAATTTTCAACAAACTCTGGCGAGGCGGAGGCCAAGTCCCTTCTCGTACCCAGCGAGGCCCATAGCCTTGTGAGA
AGTAACCTCCAAGTCGTCCAAACACCTCTTATCGACCATGCTGTTCTCAAAGTCAAGGCAGCGAGCAGCGTTCTG
TGCTGCTCCTGCGAGAGACAGACTCGGGTCCAAGATTCAATTTATAGTTGCACACTGTGCGGACATACCGCTTGC
AAATCCTGTCGTGGAAACCCCACGCATTCATATCTACATGTTTCCCCACTTTCTCGACAAAAGCCGTCTGAATTC
ATAGCGAATTTGAAGGCGCTTGTTCCGATGAAGCTTATGCTGTCTGATCTGTCCGACTTGGGGTTTGAGATGTTT
AGATCCCTTTACCACATCACCAACCTCCCCCGGTTTTGGCCCGACTTCATTATGTGCGTCAAGGCGGCTGTGCAC
GATGTCTTTCGATTTTTTGAGATTAAGCGAGGAAGAAAATGGCGAGTGGTTTATGACGGCACGCATTCCAGCTTG
TACCTTGATATCGGTCCGGACTCCTTCCAGTGGCTGTTGTACGCGAAGCCCCCCAAGTCCGCGAGTAGGAGAAGC
GTCATCCGGGAAGTTCTAGCCAAGCCAATTGCCAGAATGAGTCCAACTTCTGGGTCGCTTGTCGAGGGTACATGG
GAAATTTCCTCACCCATTAGCACCCCAATTTTACTTCAGATTTCTGGCAGAGGACACCAAGTTCGATCATTCCAA
TCGGAGTGTGGTATTAAAGCCGCTAAATTTGTTGATGGAAAAGTCTGGGACAGTATTTTCGTTGAAGGATCAGAT
CAAAACGTCGCAGCTCTGGATTTCGACGTCCGAGGAATGTACCAATTCCTCCCTGATTGTGGAACAGCCCTTGGT
GCATTGTACAGAAGAAAAGCTACCGCCCATGCACCCCGAATTTTCCTATTCCTTGACCCAGCAAAGATTGGACCA
GCAGACGAAGATGCCTTTGTATTCGCTCTTGAACACGACCGCCTTCCTGGATATGATGTGAGAATGACGATCGCC
GAGTTATCTTCAAAGTGGACATCATTAAATGTCACCATGGATTCGCAAGATGTGAAAGCTTTCTGTCGTCGATGG
GCCAAGGCCCCCAAGGCACATCTGAACCAATGTCCTGCCGAGCAGATTACCCTCCACACATTGCAACAAGGAATG
CAAGTCTCGATTGAAAACCAGAACTGTCATGATGCTTGTATAACTCTCACCTCGCTGTCAGCAACGACATCGATT
CTCAACCTACCTGACGCAAATTCCGATTGGCAAGCCTGGAATCCAGAGGTCTCTATGAGAGAATTGAAAGGTCTC
GCTTGGTTGTTCCCGAAGATTGCTGCGTGGTCCGACTTTAAAGACTGGAACGAAATCATCCTCCCGGATTGTTCA
GACCTCAAACATCATGCAAATGGCAATTGCAACACCTGCAACCCACCCACCCCTAGTATCCTTTGGGGCCGGGAC
AACAGAGATCGAATCATCCCATACGAGAATCCGCAGGACGCTGCCGTCTACGAGCGTGCCATCAAAAACCGACCC
TCGCCATTTTTGGTCTTCAGACGAATCAACGAACATGGAGATGCTGAACTGCGTTTCACTCTCAATGTGCAAGCT
TTGACCCATCAGGCACATGGTAAATTGTTTGGTACCGCAAGCCATGAGGGAGTAACATCTTTCTGGCGACTTCTC
CCTCATGCGTACGACATGAGTCAAGAAACCCCTGGCATTTTTACTTTGAGGAGCAACGACAACGATAGTCTTTCG
CCACAACCTCCCAATTTCAAATTCAAGCTTCGTGATGAACAGCTTCGATCACTGAGCTGGATGATTACACAAGAA
GCAAAAGAGATGGAACCATTCATGGAAGAGGAAGTTGAAGAATCCATCCTCCCCTTAATGCCTTGGCGTGCCGAA
GTCAAAGCGACAATGCCAAAAGTTGTTCGCGGTGGCGTGCTAGCCGACGAAGTTGGATACGGCAAGACGGCTGTT
ATTCTTGGTCTTATTGACACGCAGTATGAAAGCGACTGCAAACCCCCTGAAGAGAACGGGCTGATTTCAACCAAA
GCAACACTGATCATCGTGCCCAGCAACGTCTTCAAGCAGTGGGTTTCGGAGACCAAGAAGTTCCTTGGAGGAAAA
TACAAAGTTTTGGCAATATCCTCGATCAGCAAGATCACAATCCGGGAAGTCGAAGATGCAGATATCGTGATTTTG
TCATGGAGTATCCTGGCGAACGATGCATACTACAGCCGACTTCAACAATTTACCGGAACACCCCAAGCTCCCGCA
AAATCGAGCGGAGGAACAGGTCGAAATTTCGATAGCTGGTTTCACAATGCTCGTGCTTCCTTGCGGGAGTCTGTT
GACATATTGAAAACACAAGGATCTGAGGCAATGCTTCGGCAATTGGAAGCCAGACGTCGCCGAGTTCAAGAGACA
CAGGCCAATTTTACTTACGTGCCCTCTCGGCGCCTGCGTGGCCAGGCATTTGCTGATGCTAAAAATGGTCGTGAT
GAATGCAATGCAGGAGAAGAAAGGAATTTGGATTCTGAGTCTGACTCGGGTTTCGAGGACTTTGGCGCATCTGAT
GCGAGACAGTCCCCCGAAGCGGGCCAGCGCAAGCGGAGGCACAGTAGGAAGTCAGTGGAAGGTCCAAGAGGAAAG
CGACAAAAACACTCATTGACAGAGCTGACCGAAGTAACCGATGACGGAAAGAAACTTGGAGCCAAATCAACTGCC
GTGAAAGATGACCGCAAAGATTTTGATATCAATAAGACCGCCGAACACGACTGGCGCACTGTCAAAGCCGCATTT
ATTCACGCTTTCAACTTCAACCGTTTGGTAATCGACGAATATACATATGCCGGGGAGGAAAGACAGGCTTCTCTG
CTCTCATTGCAGGCACGCTCTAAATGGATCCTTTCTGGAACGCCAGCTCTTCGTGAATTTGCCGACATTAAGAGT
GTTGCGCGTTACCTTGGCTTACACCTTGGTGTGGACGACGATGGCGATTGCGACAAGCCGACGCAGAACAGCAGA
CTACGAAACATCCGGAAGAACCACACAGCTGTTGAGGCATTCCAATATTACCAGGCCCCCCACAGCAACGCCTGG
TACCAAAACCGCCGAGAACATGCCCAAAACTTCCTTGACCGATTTGCGCGTCAGAACATCGCACGCATCACACAT
ATCCCGTTGAAGACAACCTTTGTCGTCACCGAACAGTCGCCTGCTGAAAAGACAGCGTACGATACATTGTTGCGA
GCTGTCAAGGAAAATAAGAGACGGATTCCTGGCCCCTTGAGCACCATTTTGTCTAAGAGCCAGGTCCCCCAAGAG
GCTCTCATCATGTCCTGCGTCACAAATCAAATCGGACAACCTCCATGGAACCTCGAGAAGTGCCGAAAAGGCTCG
CAGAATGACAAAAAGAAATCCGCTGAGATCTGGACTAAAGTGGACTCGATCACTCGACAGGCAGCGATTGTTTGG
TATCGCGAATTGAAAAATACCGATCCCAACAACTGGCAAAAGGCCCTGAATGGCGTCGCCAAGATTGATTTTGGG
GACGCGCAACTCAACAAAAGATTCAAACAGCTCTTAGAGGACATCATCCGCTCATACAGTGAGTGGAAACTCGCC
GAACAACACCAGCCAATTGATGATTTGCTCCAACAGCGATTCCAAAAGATACAAAATTCGAAGACTGGCAACAAA
GCGACTGGAAAGCGTCCTCCTAGAGCCACAGAATATGGAAAACCCGTGGATGCGTTTTCCAATTCGGTTTGGATC
GCTGTCGAAAAAACCTTGTCCGCTGATGTCACCTCTCTCTTGAAACAGGTCCTCGAGATTGACCGGGAATACCGA
TTCTACGAACATCTAGTGAGGATCCAAACCATTGGAATTCTTTTATGTCAAAAATGTAATGGCGACTTGCAAGAA
AAAGAAGACGTCAACGTCCTCAAAACCTGCGGTCATGTCCTCTGCAAAGATTGTATTGCCGCCGGATCACGCAAA
CCCTGCCCTATCATTGGATGCGGCGGCCAAATTGTCCAATCCAAGATCGTGCCCGGTGAAATCCTTGTCAGCGAA
GACCAAGAAATCCAGAGCACCAAGCTCAACAAGCTAGTTGAGATCGTCCGCAATGTCCCAGAGGAAGAGCTTGTC
CTCATCTTTGTGCAAATCAATCATCTGTTACCTGTGGTATCGAATGCCCTAAAAGCTGCGAACATCGACCACCGC
ATGGTCACACAGACTAACTTGAAGGGAATCGATGAGTTCACTGAGGCTCCGAAACTAAAAAAGGGCATGACGCAA
CCACCTTCTAGACCGAAGGCTTTGATCTTGAATCTCGGAAACTCCATGGCAGCTGGATTGAATCTCCAATGCGCA
AACCACGTTATCTTCTTGTCGCCATATTTCGCCCCCTCTGACCATGACTTTGAGGCAGGCATGACCCAGGCAGTC
GGACGTGCACGGCGATTCGGACAGGAGCGCGAGGTCCATGTCTATCATTTGCTGGTGAAGAACACATACGAAGTC
AACATCTTCCAGAACGCTCAATCAAGCAAACTCGTTGAGCGTCAAGGTGTCCACGTTTTGGTTCCCGAAGAAGAA
GTATTACCAAACGACATCGGATGCGAAGGGGAGGAGATGCCAGAGTAG
Transcript >Pro_DTO377G3_2|g7981.t1
ATGGTGTCAAAGGGAATTTCTCAGCAGCAGTCGGGGGATGGTTTGGCAATGGATGATCAGGAGTCTAGTGCCGGG
GCCGATGAGATTCCTGAGCTGCGGCGGGGACGCATGATCCCTTCGGGTCGGTATCTAGCCAATAACCTCCCCCCT
CTGCATACGCTGAGAGAAATTTTTGCTGACATGGCATCAAAGGCCATGGAAATTGGACTCGAGCAAGTCCTCATT
CGGCTCGGCAGTCGACCACTTCGAGTGGCGACAATGTGCTCAGGAACCGAAGCCCCGCTTCTAGCCCTGGAATTG
ATACAGAAGGGTTTGCCGGAGGCCCAGCAACTTCGGATCTTGCACGCTTTCAGCTGTGAGATTGTTCCATTCAAG
CAGTCGTACATTGAGCGAAACTTCCGCCCCCCTCTCCTCTTTCGGGACATCACCGAACTTGGAGGAGACGAGGCG
CGGACCGCCTACGGGTCATTAGAAGCAATTCCCGGTAACCTCGACATATTAGTTGCTGGAACTGCCTGTGTCGAC
TTCTCTCCTTTGAACAACCGCCAGAAGACGCTGCAGCAAGGCGGCGAGTCGGGAGCTACGTTCGACGGTCTCTTG
CGGTACGCGAAGAGATATCGACCCCGCATGATCGTTCAGGAGAATGTCCGGAATGCGCCCTGGGAGCAGATGAAG
GGGAAGTGGGAGGAGCTCAGGTACATGTCCGTTTGTGTCAATGTCGACACGAAGCATTACTACATCCCGCAGACA
CGCGAGCGCGGGTACATGGTGGTTATTGACAAGCACCGCTTGGAAGCAGCGGGCCTACTTGGAGACACCATGGAT
CAAAGTGGCATTGAAATTGTCACTCAACGCGTTCGTGAGCTAGCTGATCGTTTCAAACGGCCAGCGAGTGCACCG
GTGGGGTTGTTCTTGCTGAGTGATGACGATCGCCGACTCGAGCTCATCGAGATGAGAGCCCGCCTTGAGTCCCGA
AGCGAAACCAGCTGGGATCAGTACCAGATTCGTCACCAACGGCACCGTGACGAACTGGAACTAGGTAGCGAGAGG
CCAATCACTCGATCCCTTCCCGGGATCAATGAACTGAAGACACCGGACTTCTATTGGCATCGTTTCTGGAAGACA
CAGTCGGAGAGAGTGTGGGAGACCGTGGATATGAATTTCCTGAAGAAGATGCTTCAAGATTATGACATGAACTTC
AAGGAGCGTTGGATTGACTTATCTCAGGGCGTCGATCGAGGGAATGACAGCCTTGCCGGTTCTGGTATCGCAGGG
TGTCTGACACCGAAGGGCATGCCATTTGTGACAACCCGCGGCGGCCCCGTATCTGGCACGGAGGCTCTTTCGTTG
CAAGGACTGCCCCTCGATCGAATGTTACTCACGAGAGAAACCCAAGCCGATTTGATGGATATGGCAGGAAATGCA
ATGACGAGTACGGTAGTGTGTGCAATCATGCTGGCTGGTCTGATAGCCGTGCATGAGATTCTTGACGACGGCGAG
GAATTTTCAACAAACTCTGGCGAGGCGGAGGCCAAGTCCCTTCTCGTACCCAGCGAGGCCCATAGCCTTGTGAGA
AGTAACCTCCAAGTCGTCCAAACACCTCTTATCGACCATGCTGTTCTCAAAGTCAAGGCAGCGAGCAGCGTTCTG
TGCTGCTCCTGCGAGAGACAGACTCGGGTCCAAGATTCAATTTATAGTTGCACACTGTGCGGACATACCGCTTGC
AAATCCTGTCGTGGAAACCCCACGCATTCATATCTACATGTTTCCCCACTTTCTCGACAAAAGCCGTCTGAATTC
ATAGCGAATTTGAAGGCGCTTGTTCCGATGAAGCTTATGCTGTCTGATCTGTCCGACTTGGGGTTTGAGATGTTT
AGATCCCTTTACCACATCACCAACCTCCCCCGGTTTTGGCCCGACTTCATTATGTGCGTCAAGGCGGCTGTGCAC
GATGTCTTTCGATTTTTTGAGATTAAGCGAGGAAGAAAATGGCGAGTGGTTTATGACGGCACGCATTCCAGCTTG
TACCTTGATATCGGTCCGGACTCCTTCCAGTGGCTGTTGTACGCGAAGCCCCCCAAGTCCGCGAGTAGGAGAAGC
GTCATCCGGGAAGTTCTAGCCAAGCCAATTGCCAGAATGAGTCCAACTTCTGGGTCGCTTGTCGAGGGTACATGG
GAAATTTCCTCACCCATTAGCACCCCAATTTTACTTCAGATTTCTGGCAGAGGACACCAAGTTCGATCATTCCAA
TCGGAGTGTGGTATTAAAGCCGCTAAATTTGTTGATGGAAAAGTCTGGGACAGTATTTTCGTTGAAGGATCAGAT
CAAAACGTCGCAGCTCTGGATTTCGACGTCCGAGGAATGTACCAATTCCTCCCTGATTGTGGAACAGCCCTTGGT
GCATTGTACAGAAGAAAAGCTACCGCCCATGCACCCCGAATTTTCCTATTCCTTGACCCAGCAAAGATTGGACCA
GCAGACGAAGATGCCTTTGTATTCGCTCTTGAACACGACCGCCTTCCTGGATATGATGTGAGAATGACGATCGCC
GAGTTATCTTCAAAGTGGACATCATTAAATGTCACCATGGATTCGCAAGATGTGAAAGCTTTCTGTCGTCGATGG
GCCAAGGCCCCCAAGGCACATCTGAACCAATGTCCTGCCGAGCAGATTACCCTCCACACATTGCAACAAGGAATG
CAAGTCTCGATTGAAAACCAGAACTGTCATGATGCTTGTATAACTCTCACCTCGCTGTCAGCAACGACATCGATT
CTCAACCTACCTGACGCAAATTCCGATTGGCAAGCCTGGAATCCAGAGGTCTCTATGAGAGAATTGAAAGGTCTC
GCTTGGTTGTTCCCGAAGATTGCTGCGTGGTCCGACTTTAAAGACTGGAACGAAATCATCCTCCCGGATTGTTCA
GACCTCAAACATCATGCAAATGGCAATTGCAACACCTGCAACCCACCCACCCCTAGTATCCTTTGGGGCCGGGAC
AACAGAGATCGAATCATCCCATACGAGAATCCGCAGGACGCTGCCGTCTACGAGCGTGCCATCAAAAACCGACCC
TCGCCATTTTTGGTCTTCAGACGAATCAACGAACATGGAGATGCTGAACTGCGTTTCACTCTCAATGTGCAAGCT
TTGACCCATCAGGCACATGGTAAATTGTTTGGTACCGCAAGCCATGAGGGAGTAACATCTTTCTGGCGACTTCTC
CCTCATGCGTACGACATGAGTCAAGAAACCCCTGGCATTTTTACTTTGAGGAGCAACGACAACGATAGTCTTTCG
CCACAACCTCCCAATTTCAAATTCAAGCTTCGTGATGAACAGCTTCGATCACTGAGCTGGATGATTACACAAGAA
GCAAAAGAGATGGAACCATTCATGGAAGAGGAAGTTGAAGAATCCATCCTCCCCTTAATGCCTTGGCGTGCCGAA
GTCAAAGCGACAATGCCAAAAGTTGTTCGCGGTGGCGTGCTAGCCGACGAAGTTGGATACGGCAAGACGGCTGTT
ATTCTTGGTCTTATTGACACGCAGTATGAAAGCGACTGCAAACCCCCTGAAGAGAACGGGCTGATTTCAACCAAA
GCAACACTGATCATCGTGCCCAGCAACGTCTTCAAGCAGTGGGTTTCGGAGACCAAGAAGTTCCTTGGAGGAAAA
TACAAAGTTTTGGCAATATCCTCGATCAGCAAGATCACAATCCGGGAAGTCGAAGATGCAGATATCGTGATTTTG
TCATGGAGTATCCTGGCGAACGATGCATACTACAGCCGACTTCAACAATTTACCGGAACACCCCAAGCTCCCGCA
AAATCGAGCGGAGGAACAGGTCGAAATTTCGATAGCTGGTTTCACAATGCTCGTGCTTCCTTGCGGGAGTCTGTT
GACATATTGAAAACACAAGGATCTGAGGCAATGCTTCGGCAATTGGAAGCCAGACGTCGCCGAGTTCAAGAGACA
CAGGCCAATTTTACTTACGTGCCCTCTCGGCGCCTGCGTGGCCAGGCATTTGCTGATGCTAAAAATGGTCGTGAT
GAATGCAATGCAGGAGAAGAAAGGAATTTGGATTCTGAGTCTGACTCGGGTTTCGAGGACTTTGGCGCATCTGAT
GCGAGACAGTCCCCCGAAGCGGGCCAGCGCAAGCGGAGGCACAGTAGGAAGTCAGTGGAAGGTCCAAGAGGAAAG
CGACAAAAACACTCATTGACAGAGCTGACCGAAGTAACCGATGACGGAAAGAAACTTGGAGCCAAATCAACTGCC
GTGAAAGATGACCGCAAAGATTTTGATATCAATAAGACCGCCGAACACGACTGGCGCACTGTCAAAGCCGCATTT
ATTCACGCTTTCAACTTCAACCGTTTGGTAATCGACGAATATACATATGCCGGGGAGGAAAGACAGGCTTCTCTG
CTCTCATTGCAGGCACGCTCTAAATGGATCCTTTCTGGAACGCCAGCTCTTCGTGAATTTGCCGACATTAAGAGT
GTTGCGCGTTACCTTGGCTTACACCTTGGTGTGGACGACGATGGCGATTGCGACAAGCCGACGCAGAACAGCAGA
CTACGAAACATCCGGAAGAACCACACAGCTGTTGAGGCATTCCAATATTACCAGGCCCCCCACAGCAACGCCTGG
TACCAAAACCGCCGAGAACATGCCCAAAACTTCCTTGACCGATTTGCGCGTCAGAACATCGCACGCATCACACAT
ATCCCGTTGAAGACAACCTTTGTCGTCACCGAACAGTCGCCTGCTGAAAAGACAGCGTACGATACATTGTTGCGA
GCTGTCAAGGAAAATAAGAGACGGATTCCTGGCCCCTTGAGCACCATTTTGTCTAAGAGCCAGGTCCCCCAAGAG
GCTCTCATCATGTCCTGCGTCACAAATCAAATCGGACAACCTCCATGGAACCTCGAGAAGTGCCGAAAAGGCTCG
CAGAATGACAAAAAGAAATCCGCTGAGATCTGGACTAAAGTGGACTCGATCACTCGACAGGCAGCGATTGTTTGG
TATCGCGAATTGAAAAATACCGATCCCAACAACTGGCAAAAGGCCCTGAATGGCGTCGCCAAGATTGATTTTGGG
GACGCGCAACTCAACAAAAGATTCAAACAGCTCTTAGAGGACATCATCCGCTCATACAGTGAGTGGAAACTCGCC
GAACAACACCAGCCAATTGATGATTTGCTCCAACAGCGATTCCAAAAGATACAAAATTCGAAGACTGGCAACAAA
GCGACTGGAAAGCGTCCTCCTAGAGCCACAGAATATGGAAAACCCGTGGATGCGTTTTCCAATTCGGTTTGGATC
GCTGTCGAAAAAACCTTGTCCGCTGATGTCACCTCTCTCTTGAAACAGGTCCTCGAGATTGACCGGGAATACCGA
TTCTACGAACATCTAGTGAGGATCCAAACCATTGGAATTCTTTTATGTCAAAAATGTAATGGCGACTTGCAAGAA
AAAGAAGACGTCAACGTCCTCAAAACCTGCGGTCATGTCCTCTGCAAAGATTGTATTGCCGCCGGATCACGCAAA
CCCTGCCCTATCATTGGATGCGGCGGCCAAATTGTCCAATCCAAGATCGTGCCCGGTGAAATCCTTGTCAGCGAA
GACCAAGAAATCCAGAGCACCAAGCTCAACAAGCTAGTTGAGATCGTCCGCAATGTCCCAGAGGAAGAGCTTGTC
CTCATCTTTGTGCAAATCAATCATCTGTTACCTGTGGTATCGAATGCCCTAAAAGCTGCGAACATCGACCACCGC
ATGGTCACACAGACTAACTTGAAGGGAATCGATGAGTTCACTGAGGCTCCGAAACTAAAAAAGGGCATGACGCAA
CCACCTTCTAGACCGAAGGCTTTGATCTTGAATCTCGGAAACTCCATGGCAGCTGGATTGAATCTCCAATGCGCA
AACCACGTTATCTTCTTGTCGCCATATTTCGCCCCCTCTGACCATGACTTTGAGGCAGGCATGACCCAGGCAGTC
GGACGTGCACGGCGATTCGGACAGGAGCGCGAGGTCCATGTCTATCATTTGCTGGTGAAGAACACATACGAAGTC
AACATCTTCCAGAACGCTCAATCAAGCAAACTCGTTGAGCGTCAAGGTGTCCACGTTTTGGTTCCCGAAGAAGAA
GTATTACCAAACGACATCGGATGCGAAGGGGAGGAGATGCCAGAGTAG
Gene >Pro_DTO377G3_2|g7981.t1
ATGGTGTCAAAGGGAATTTCTCAGCAGCAGTCGGGGGATGGTTTGGCAATGGATGATCAGGAGTCTAGTGCCGGG
GCCGATGAGATTCCTGAGCTGCGGCGGGGACGCATGATCCCTTCGGGTCGGTATCTAGCCAATAACCTCCCCCCT
CTGCATACGCTGAGAGAAATTTTTGCTGACATGGCATCAAAGGCCATGGAAATTGGACTCGAGCAAGTCCTCATT
CGGCTCGGCAGTCGACCACTTCGAGTGGCGACAATGTGCTCAGGAACCGAAGCCCCGCTTCTAGCCCTGGAATTG
ATACAGAAGGGTAAGTGCAGGCAGTGCAGCATCTCGTTTTTCTTTTATTTCCCATTTCCCCCAGTCGGTCGTTTG
TTGTCTTCGTGTTGAGGTTCATGTTGTAGCTGGTTCCATGGTTGAGGCCTTGTCCCGACTTCTAAGTCACATGTT
TCCTTCCTTGCCCTAACTTTGCCTTAACCTCGCCCTGACTTCCATGGCATGATCGCTTTTGCCTGGTAATGATTT
CCACCTCATTCCAGTGACTCGGTCTGACCTCTCTCACTCTCTGCTTGGTGCTTCTTGGAATATGACCATGGAACA
ATTGCTAATTTTACCTTGATAGGTTTGCCGGAGGCCCAGCAACTTCGGATCTTGCACGCTTTCAGCTGTGAGATT
GTTCCATTCAAGCAGTCGTACATTGAGCGAAACTTCCGCCCCCCTCTCCTCTTTCGGGACATCACCGAACTTGGA
GGAGACGAGGCGTAAGTACCCCATCCATCTTCCTCTGACATGACTCTAATACTGACTTTGATTTTCAAGGCGGAC
CGCCTACGGGTCATTAGAAGCAATTCCCGGTAACCTCGACATATTAGTTGCTGGAACTGCCTGTGTCGACTTCTC
TCCTTTGAACAACCGCCAGAAGACGCTGCAGCAAGGCGGCGAGTCGGGAGCTACGTTCGACGGTCTCTTGCGGTA
CGCGAAGAGATATCGACCCCGCATGATCGTTCAGGAGAATGTCCGGAATGCGCCCTGGGAGCAGATGAAGGGGAA
GTGGGAGGAGCTCAGGTACATGTCCGTTTGTGTCAATGTCGACACGAAGCATTACTACATCCCGCAGACACGCGA
GCGCGGGTACATGGTGGTTATTGACAAGCACCGCTTGGAAGCAGCGGGCCTACTTGGAGACACCATGGATCAAAG
TGGCATTGAAATTGTCACTCAACGCGTTCGTGAGCTAGCTGATCGTTTCAAACGGCCAGCGAGTGCACCGGTGGG
GTTGTTCTTGCTGAGTGATGACGATCGCCGACTCGAGCTCATCGAGATGAGAGCCCGCCTTGAGTCCCGAAGCGA
AACCAGCTGGGATCAGTACCAGATTCGTCACCAACGGCACCGTGACGAACTGGAACTAGGTAGCGAGAGGCCAAT
CACTCGATCCCTTCCCGGGATCAATGAACTGAAGACACCGGACTTCTATTGGCATCGTTTCTGGAAGACACAGTC
GGAGAGAGTGTGGGAGACCGTGGATATGAATTTCCTGAAGAAGATGCTTCAAGATTATGACATGAACTTCAAGGA
GTAAGTCTACTCAATCTTCACTTCAGGAATATTGTACTAACAATTCACTTCACAGGCGTTGGATTGACTTATCTC
AGGGCGTCGATCGAGGGAATGACAGCCTTGCCGGTTCTGGTATCGCAGGGTGTCTGACACCGAAGGGCATGCCAT
TTGTGACAACCCGCGGCGGCCCCGTATCTGGCACGGAGGCTCTTTCGTTGCAAGGACTGCCCCTCGATCGAATGT
TACTCACGAGAGAAACCCAAGCCGATTTGATGGATATGGCAGGAAATGCAATGACGAGTACGGTAGTGTGTGCAA
TCATGCTGGCTGGTCTGATAGCCGTGCATGAGATTCTTGACGACGGCGAGGAATTTTCAACAAACTCTGGCGAGG
CGGAGGCCAAGTCCCTTCTCGTACCCAGCGAGGCCCATAGCCTTGTGAGAAGTAACCTCCAAGTCGTCCAAACAC
CTCTTATCGACCATGCTGTTCTCAAAGTCAAGGCAGCGAGCAGCGTTCTGTGCTGCTCCTGCGAGAGACAGACTC
GGGTCCAAGATTCAATTTATAGTTGCACACTGTGCGGACATACCGCTTGCAAATCCTGTCGTGGAAACCCCACGC
ATTCATATCTACATGTTTCCCCACTTTCTCGACAAAAGCCGTCTGAATTCATAGCGAATTTGAAGGCGCTTGTTC
CGATGAAGCTTATGCTGTCTGATCTGTCCGACTTGGGGTTTGAGATGTTTAGATCCCTTTACCACATCACCAACC
TCCCCCGGTTTTGGCCCGACTTCATTATGTGCGTCAAGGCGGCTGTGCACGATGTCTTTCGATTTTTTGAGATTA
AGCGAGGAAGAAAATGGCGAGTGGTTTATGACGGCACGCATTCCAGCTTGTACCTTGATATCGGTCCGGACTCCT
TCCAGTGGCTGTTGTACGCGAAGCCCCCCAAGTCCGCGAGTAGGAGAAGCGTCATCCGGGAAGTTCTAGCCAAGC
CAATTGCCAGAATGAGTCCAACTTCTGGGTCGCTTGTCGAGGGTACATGGGAAATTTCCTCACCCATTAGCACCC
CAATTTTACTTCAGATTTCTGGCAGAGGACACCAAGTTCGATCATTCCAATCGGAGTGTGGTATTAAAGCCGCTA
AATTTGTTGATGGAAAAGTCTGGGACAGTATTTTCGTTGAAGGATCAGATCAAAACGTCGCAGCTCTGGATTTCG
ACGTCCGAGGAATGTACCAATTCCTCCCTGATTGTGGAACAGCCCTTGGTGCATTGTACAGAAGAAAAGCTACCG
CCCATGCACCCCGAATTTTCCTATTCCTTGACCCAGCAAAGATTGGACCAGCAGACGAAGATGCCTTTGTATTCG
CTCTTGAACACGACCGCCTTCCTGGATATGATGTGAGAATGACGATCGCCGAGTTATCTTCAAAGTGGACATCAT
TAAATGTCACCATGGATTCGCAAGATGTGAAAGCTTTCTGTCGTCGATGGGCCAAGGCCCCCAAGGCACATCTGA
ACCAATGTCCTGCCGAGCAGATTACCCTCCACACATTGCAACAAGGAATGCAAGTCTCGATTGAAAACCAGAACT
GTCATGATGCTTGTATAACTCTCACCTCGCTGTCAGCAACGACATCGATTCTCAACCTACCTGACGCAAATTCCG
ATTGGCAAGCCTGGAATCCAGAGGTCTCTATGAGAGAATTGAAAGGTCTCGCTTGGTTGTTCCCGAAGATTGCTG
CGTGGTCCGACTTTAAAGACTGGAACGAAATCATCCTCCCGGATTGTTCAGACCTCAAACATCATGCAAATGGCA
ATTGCAACACCTGCAACCCACCCACCCCTAGTATCCTTTGGGGCCGGGACAACAGAGATCGAATCATCCCATACG
AGAATCCGCAGGACGCTGCCGTCTACGAGCGTGCCATCAAAAACCGACCCTCGCCATTTTTGGTCTTCAGACGAA
TCAACGAACATGGAGATGCTGAACTGCGTTTCACTCTCAATGTGCAAGCTTTGACCCATCAGGCACATGGTAAAT
TGTTTGGTACCGCAAGCCATGAGGGAGTAACATCTTTCTGGCGACTTCTCCCTCATGCGTACGACATGAGTCAAG
AAACCCCTGGCATTTTTACTTTGAGGAGCAACGACAACGATAGTCTTTCGCCACAACCTCCCAATTTCAAATTCA
AGCTTCGTGATGAACAGCTTCGATCACTGAGCTGGATGATTACACAAGAAGCAAAAGAGATGGAACCATTCATGG
AAGAGGAAGTTGAAGAATCCATCCTCCCCTTAATGCCTTGGCGTGCCGAAGTCAAAGCGACAATGCCAAAAGTTG
TTCGCGGTGGCGTGCTAGCCGACGAAGTTGGATACGGCAAGACGGCTGTTATTCTTGGTCTTATTGACACGCAGT
ATGAAAGCGACTGCAAACCCCCTGAAGAGAACGGGCTGATTTCAACCAAAGCAACACTGATCATCGTGCCCAGCA
ACGTCTTCAAGCAGTGGGTTTCGGAGACCAAGAAGTTCCTTGGAGGAAAATACAAAGTTTTGGCAATATCCTCGA
TCAGCAAGATCACAATCCGGGAAGTCGAAGATGCAGATATCGTGATTTTGTCATGGAGTATCCTGGCGAACGATG
CATACTACAGCCGACTTCAACAATTTACCGGAACACCCCAAGCTCCCGCAAAATCGAGCGGAGGAACAGGTCGAA
ATTTCGATAGCTGGTTTCACAATGCTCGTGCTTCCTTGCGGGAGTCTGTTGACATATTGAAAACACAAGGATCTG
AGGCAATGCTTCGGCAATTGGAAGCCAGACGTCGCCGAGTTCAAGAGACACAGGCCAATTTTACTTACGTGCCCT
CTCGGCGCCTGCGTGGCCAGGCATTTGCTGATGCTAAAAATGGTCGTGATGAATGCAATGCAGGAGAAGAAAGGA
ATTTGGATTCTGAGTCTGACTCGGGTTTCGAGGACTTTGGCGCATCTGATGCGAGACAGTCCCCCGAAGCGGGCC
AGCGCAAGCGGAGGCACAGTAGGAAGTCAGTGGAAGGTCCAAGAGGAAAGCGACAAAAACACTCATTGACAGAGC
TGACCGAAGTAACCGATGACGGAAAGAAACTTGGAGCCAAATCAACTGCCGTGAAAGATGACCGCAAAGATTTTG
ATATCAATAAGACCGCCGAACACGACTGGCGCACTGTCAAAGCCGCATTTATTCACGCTTTCAACTTCAACCGTT
TGGTAATCGACGAATATACATATGCCGGGGAGGAAAGACAGGCTTCTCTGCTCTCATTGCAGGCACGCTCTAAAT
GGATCCTTTCTGGAACGCCAGCTCTTCGTGAATTTGCCGACATTAAGAGTGTTGCGCGTTACCTTGGCTTACACC
TTGGTGTGGACGACGATGGCGATTGCGACAAGCCGACGCAGAACAGCAGACTACGAAACATCCGGAAGAACCACA
CAGCTGTTGAGGCATTCCAATATTACCAGGCCCCCCACAGCAACGCCTGGTACCAAAACCGCCGAGAACATGCCC
AAAACTTCCTTGACCGATTTGCGCGTCAGAACATCGCACGCATCACACATATCCCGTTGAAGACAACCTTTGTCG
TCACCGAACAGTCGCCTGCTGAAAAGACAGCGTACGATACATTGTTGCGAGCTGTCAAGGAAAATAAGAGACGGA
TTCCTGGCCCCTTGAGCACCATTTTGTCTAAGAGCCAGGTCCCCCAAGAGGCTCTCATCATGTCCTGCGTCACAA
ATCAAATCGGACAACCTCCATGGAACCTCGAGAAGTGCCGAAAAGGCTCGCAGAATGACAAAAAGAAATCCGCTG
AGATCTGGACTAAAGTGGACTCGATCACTCGACAGGCAGCGATTGTTTGGTATCGCGAATTGAAAAATACCGATC
CCAACAACTGGCAAAAGGCCCTGAATGGCGTCGCCAAGATTGATTTTGGGGACGCGCAACTCAACAAAAGATTCA
AACAGCTCTTAGAGGACATCATCCGCTCATACAGTGAGTGGAAACTCGCCGAACAACACCAGCCAATTGATGATT
TGCTCCAACAGCGATTCCAAAAGATACAAAATTCGAAGACTGGCAACAAAGCGACTGGAAAGCGTCCTCCTAGAG
CCACAGAATATGGAAAACCCGTGGATGCGTTTTCCAATTCGGTTTGGATCGCTGTCGAAAAAACCTTGTCCGCTG
ATGTCACCTCTCTCTTGAAACAGGTCCTCGAGATTGACCGGGAATACCGATTCTACGAACATCTAGTGAGGATCC
AAACCATTGGAATTCTTTTATGTCAAAAATGTAATGGCGACTTGCAAGAAAAAGAAGACGTCAACGTCCTCAAAA
CCTGCGGTCATGTCCTCTGCAAAGATTGTATTGCCGCCGGATCACGCAAACCCTGCCCTATCATTGGATGCGGCG
GCCAAATTGTCCAATCCAAGATCGTGCCCGGTGAAATCCTTGTCAGCGAAGACCAAGAAATCCAGAGCACCAAGC
TCAACAAGCTAGTTGAGATCGTCCGCAATGTCCCAGAGGAAGAGCTTGTCCTCATCTTTGTGCAAATCAATCATC
TGTTACCTGTGGTATCGAATGCCCTAAAAGCTGCGAACATCGACCACCGCATGGTCACACAGACTAACTTGAAGG
GAATCGATGAGTTCACTGAGGCTCCGAAACTAAAAAAGGGCATGACGCAACCACCTTCTAGACCGAAGGCTTTGA
TCTTGAATCTCGGAAACTCCATGGCAGCTGGATTGTAGGTCATTTCTCTCTGCTATTACCCGTTATTCTTGTTAG
AAACGTTACTAATATGATCCAATCAAAGGAATCTCCAATGCGCAAACCACGTTATCTTCTTGTCGCCATATTTCG
CCCCCTCTGACCATGACTTTGAGGCAGGCATGACCCAGGCAGTCGGACGTGCACGGCGATTCGGACAGGAGCGCG
AGGTCCATGTCTATCATTTGCTGGTGAAGAACACATACGAAGTCAACATCTTCCAGAACGCTCAATCAAGCAAAC
TCGTTGAGCGTCAAGGTGTCCACGTTTTGGTTCCCGAAGAAGAAGTATTACCAAACGACATCGGATGCGAAGGGG
AGGAGATGCCAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail