Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7977.t1
Gene name
Locationscaffold_28:30897..34687
Strand+
Gene length (bp)3790
Transcript length (bp)3672
Coding sequence length (bp)3672
Protein length (aa) 1224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.0E-87 673 945
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 3.0E-48 27 188
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 5.9E-11 212 287
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.4E-17 565 662
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 6.7E-13 1139 1214

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 105 127 22
3 167 186 19
4 672 694 22
5 725 747 22
6 768 790 22
7 824 846 22
8 881 903 22
9 926 948 22
10 961 978 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7977.t1
MTSGLEEALEHTGGHGRTAEGVSISTFLASLATAIVVFVVEFLLFLLLKGKLSRIYQPRTYLVPDRERTTPSPPG
LFHWIVPVFRTSSSEFIQKCGLDAYFFLRYLRMLLKIFLPLGLVILPVLLPINRAGGKGQTYENGTSGTRYSVTG
LDQLAWGNVTPEHTSRYWAHLVMAVIAIIYVCAVFFDELRNYIRLRQAYLTSPQHRLRASATTVLVTSIPPDWLT
MDALDRLFDVFPGGVRNIWLNRNFDDLNEKVKARNHLALKLESAETELIAKCKKAQLKKAKAEAKKAGESQSSAE
KKEQKTAEKRASQMAMGPGISSGNPHQAHTVQEMLHRKPQEKRSEDGPRMFDPALAAAGAVGQGVGKLGKTVLGG
FKKPLSRTGGFVATTDNIIPPRSNTPSGPGHSATPDTLPPRANTPPVPGLLASGSQSDTKPAKPVGLRRSQHLSL
NLGKPIGPDPGQNTDQDATMCSDPPKPPFWRRMSSNTRSQGVREADQYPLTAPETPATHATYRDFEKSENEKHEH
ARKEGDEIEGERYPIAYNENFENEDYGEPLWKEYIRPKDRDTMRLPIFGWSWMPSIWLLGEKVDTIDYCRKELAR
LNLEIEVDQQHPEGFPLMNSAFIQFNHQVAAHMACQAVSHHLPKQMAPRVVEISPDDVIWDNMSIKWWERYLRSF
GIITLVCAMVVGWAFPVAFTGLLSQLAYLEGAFPWLAWLGKLPDWFISAIQGILPALCLAILMALLPLILRFLSR
TQGLFTGMSIELTVQNYYFAFLFVQLFLVVTIASSFSTIIENVTDVTSWPQLLAVNIPKSSNYFFSYMILQAMSV
SAGALVQIFGLVSWFILAPILDSTARKKWARTTNLNQMQWGTFFPVYTTLASIGLIYCVIAPLILIFNILTFGLF
WFVYRYNTLYVTKFRFDTGGLLFPRAINQLFTGIYVMEVCLIGLFFLVRNADDDVACKGQAICMIVVLVLTAGYQ
ILLNDAFNPLIRYLPVTLEDDAVRRDEEFRRAQHARLGLALDDDDDEDGDIEGSLAKREQEERRHGKEIKEMQED
IELKPLETNFPNQMRQNSDILSAPKLGDKRPSWASSSSNRKSKFFGQNSATSTPTLRDMREKMAQDTEAQAPAPS
TVGQALFAGIHDELEDLTPDERDQLVQRAFQHEALRAKRPVIWIPRDDLGVSDDEVYRTQRFSKHIWISNEYQAL
DGKCRTIFSRSPPDFSEVDLIQL*
Coding >Pro_DTO377G3_2|g7977.t1
ATGACTTCGGGCTTGGAGGAGGCGCTGGAACACACTGGCGGCCACGGCCGAACCGCCGAAGGTGTGTCAATCTCG
ACCTTCCTGGCGTCGCTGGCGACGGCCATTGTCGTTTTCGTCGTTGAATTTCTCCTCTTTCTGTTACTAAAAGGT
AAACTAAGCCGTATATATCAACCGCGAACCTATCTGGTACCAGATAGAGAACGCACAACCCCATCTCCGCCAGGC
CTCTTCCATTGGATTGTCCCAGTCTTTCGTACATCCAGCTCGGAATTCATCCAGAAATGTGGGCTTGATGCATAC
TTCTTCCTGCGCTATCTGCGCATGCTTTTGAAGATCTTCCTTCCTCTGGGCCTCGTGATATTACCTGTTCTACTT
CCAATAAACCGTGCTGGTGGCAAGGGCCAGACATACGAAAATGGTACCTCAGGCACTAGATATTCCGTCACTGGT
CTGGACCAGTTGGCATGGGGTAACGTAACCCCTGAGCACACGAGTCGGTATTGGGCTCATTTGGTAATGGCCGTG
ATTGCCATTATCTATGTCTGTGCTGTGTTTTTTGATGAACTTCGGAATTACATTCGCCTGCGACAGGCCTACTTG
ACGTCTCCCCAGCATCGACTCCGTGCTTCTGCTACCACTGTGCTCGTTACTTCTATTCCACCTGATTGGCTCACC
ATGGATGCCCTTGACAGGCTTTTCGATGTTTTCCCTGGAGGTGTGCGAAACATTTGGCTCAACCGCAACTTCGAC
GACTTGAACGAGAAAGTGAAAGCACGAAACCATCTTGCTCTCAAGCTTGAAAGCGCCGAGACAGAATTGATTGCA
AAATGCAAAAAGGCACAGCTCAAAAAGGCCAAGGCGGAGGCAAAGAAGGCCGGCGAGAGTCAATCAAGTGCAGAG
AAAAAAGAGCAAAAGACGGCTGAAAAACGGGCATCTCAAATGGCTATGGGTCCTGGTATCAGCTCTGGTAATCCT
CATCAGGCCCATACAGTACAAGAAATGCTCCACAGAAAACCCCAAGAGAAACGGTCGGAGGACGGACCTCGAATG
TTTGACCCTGCCCTTGCCGCCGCCGGGGCGGTTGGCCAAGGGGTAGGGAAACTGGGCAAAACAGTGCTTGGAGGC
TTCAAGAAACCGTTATCTCGAACTGGGGGCTTCGTTGCAACTACAGATAACATCATTCCGCCTCGTTCAAATACC
CCCTCAGGTCCCGGTCATTCTGCAACACCAGACACCCTTCCGCCTCGTGCAAACACCCCTCCAGTCCCAGGTCTT
CTTGCCTCTGGCAGCCAATCTGATACAAAACCCGCCAAACCCGTGGGGCTCCGGCGAAGTCAGCACTTGAGTTTG
AACTTAGGGAAGCCCATAGGACCGGATCCAGGACAGAATACAGACCAGGATGCCACCATGTGCAGCGATCCGCCG
AAGCCACCATTCTGGAGACGAATGTCATCTAATACAAGATCGCAGGGTGTACGCGAGGCTGACCAATATCCACTG
ACTGCACCCGAAACGCCTGCAACTCATGCCACCTATCGTGACTTCGAGAAATCCGAGAACGAAAAACACGAGCAT
GCTCGAAAGGAGGGAGACGAAATAGAAGGGGAAAGATACCCTATCGCCTATAACGAAAATTTCGAAAATGAAGAC
TACGGAGAGCCGCTGTGGAAAGAATACATCCGGCCGAAGGACCGAGATACCATGCGTCTACCCATATTTGGCTGG
AGTTGGATGCCTTCGATCTGGCTTCTAGGGGAAAAGGTTGACACCATCGATTATTGTCGAAAGGAGCTCGCTCGT
CTGAATCTGGAGATCGAAGTCGATCAGCAGCACCCCGAGGGGTTCCCTTTAATGAACTCGGCCTTCATCCAGTTC
AATCACCAAGTCGCTGCCCACATGGCCTGTCAAGCTGTCAGTCACCATCTCCCCAAGCAGATGGCACCCCGAGTC
GTGGAAATATCTCCCGATGATGTGATTTGGGATAATATGTCGATCAAGTGGTGGGAACGGTACCTGCGTTCCTTC
GGCATCATCACACTAGTTTGCGCAATGGTCGTTGGATGGGCGTTCCCCGTCGCCTTCACCGGACTACTATCACAA
TTGGCATATCTGGAGGGTGCATTTCCATGGCTTGCCTGGCTTGGCAAGCTTCCAGACTGGTTCATTTCTGCCATC
CAGGGTATTCTTCCTGCGCTGTGTTTAGCTATTCTGATGGCGCTGCTCCCTCTCATCCTTCGCTTTTTGAGCCGC
ACGCAAGGCCTCTTCACCGGCATGTCCATCGAGCTCACTGTCCAGAACTATTATTTTGCATTCCTCTTTGTGCAA
TTGTTCTTGGTTGTCACCATCGCTTCCAGTTTCTCGACGATCATTGAGAATGTCACTGATGTAACCAGCTGGCCA
CAACTCCTAGCAGTGAACATCCCGAAGTCTAGTAACTACTTCTTCTCTTACATGATTCTACAAGCCATGTCTGTG
AGCGCTGGCGCCCTTGTACAAATCTTTGGCCTGGTGAGCTGGTTCATTCTAGCTCCAATTTTGGACTCTACTGCC
CGGAAGAAGTGGGCACGAACAACAAACCTCAATCAGATGCAATGGGGTACATTCTTCCCTGTCTATACCACCCTA
GCCTCTATTGGTTTGATCTACTGTGTGATCGCACCTCTGATTCTAATTTTCAACATCCTCACCTTCGGCCTTTTC
TGGTTCGTCTATCGCTACAACACACTCTATGTGACTAAGTTTCGATTTGACACCGGTGGCCTTCTTTTTCCTCGA
GCTATTAATCAGCTATTCACGGGAATCTACGTTATGGAAGTCTGCCTAATCGGCTTGTTCTTCTTGGTTCGGAAC
GCGGATGACGATGTCGCCTGCAAGGGACAGGCTATTTGCATGATTGTTGTTCTAGTTTTGACGGCCGGTTACCAA
ATTCTTCTCAACGATGCGTTCAATCCACTGATCCGGTATCTGCCCGTTACCTTGGAAGATGATGCTGTTCGACGT
GATGAAGAGTTTCGTCGTGCTCAGCACGCTCGCCTCGGTCTCGCTCTTGACGATGACGATGACGAGGATGGTGAT
ATCGAAGGCTCCCTCGCCAAGCGTGAACAAGAAGAGCGCCGGCACGGAAAGGAGATAAAGGAGATGCAAGAAGAC
ATCGAGCTGAAACCTCTGGAGACCAATTTCCCAAACCAGATGCGACAAAACTCGGATATCTTGTCAGCACCCAAG
CTTGGAGACAAACGTCCATCATGGGCCTCCAGCTCATCAAACCGGAAATCTAAATTTTTCGGTCAGAACTCAGCA
ACCTCCACACCAACACTACGTGATATGCGGGAAAAGATGGCCCAAGACACCGAGGCCCAGGCACCAGCCCCCAGC
ACAGTCGGCCAAGCCCTCTTTGCCGGTATTCACGACGAATTAGAGGATCTTACGCCCGATGAGCGTGACCAGCTG
GTGCAACGTGCCTTCCAGCACGAGGCCCTTCGCGCCAAGCGGCCTGTCATCTGGATTCCGCGTGATGATCTGGGT
GTGAGTGATGACGAAGTGTACCGAACACAACGGTTTAGCAAACATATATGGATCAGCAATGAGTACCAGGCGCTA
GACGGCAAATGTCGGACGATCTTCAGTCGCAGTCCTCCAGATTTCTCGGAGGTGGATTTGATTCAGCTGTGA
Transcript >Pro_DTO377G3_2|g7977.t1
ATGACTTCGGGCTTGGAGGAGGCGCTGGAACACACTGGCGGCCACGGCCGAACCGCCGAAGGTGTGTCAATCTCG
ACCTTCCTGGCGTCGCTGGCGACGGCCATTGTCGTTTTCGTCGTTGAATTTCTCCTCTTTCTGTTACTAAAAGGT
AAACTAAGCCGTATATATCAACCGCGAACCTATCTGGTACCAGATAGAGAACGCACAACCCCATCTCCGCCAGGC
CTCTTCCATTGGATTGTCCCAGTCTTTCGTACATCCAGCTCGGAATTCATCCAGAAATGTGGGCTTGATGCATAC
TTCTTCCTGCGCTATCTGCGCATGCTTTTGAAGATCTTCCTTCCTCTGGGCCTCGTGATATTACCTGTTCTACTT
CCAATAAACCGTGCTGGTGGCAAGGGCCAGACATACGAAAATGGTACCTCAGGCACTAGATATTCCGTCACTGGT
CTGGACCAGTTGGCATGGGGTAACGTAACCCCTGAGCACACGAGTCGGTATTGGGCTCATTTGGTAATGGCCGTG
ATTGCCATTATCTATGTCTGTGCTGTGTTTTTTGATGAACTTCGGAATTACATTCGCCTGCGACAGGCCTACTTG
ACGTCTCCCCAGCATCGACTCCGTGCTTCTGCTACCACTGTGCTCGTTACTTCTATTCCACCTGATTGGCTCACC
ATGGATGCCCTTGACAGGCTTTTCGATGTTTTCCCTGGAGGTGTGCGAAACATTTGGCTCAACCGCAACTTCGAC
GACTTGAACGAGAAAGTGAAAGCACGAAACCATCTTGCTCTCAAGCTTGAAAGCGCCGAGACAGAATTGATTGCA
AAATGCAAAAAGGCACAGCTCAAAAAGGCCAAGGCGGAGGCAAAGAAGGCCGGCGAGAGTCAATCAAGTGCAGAG
AAAAAAGAGCAAAAGACGGCTGAAAAACGGGCATCTCAAATGGCTATGGGTCCTGGTATCAGCTCTGGTAATCCT
CATCAGGCCCATACAGTACAAGAAATGCTCCACAGAAAACCCCAAGAGAAACGGTCGGAGGACGGACCTCGAATG
TTTGACCCTGCCCTTGCCGCCGCCGGGGCGGTTGGCCAAGGGGTAGGGAAACTGGGCAAAACAGTGCTTGGAGGC
TTCAAGAAACCGTTATCTCGAACTGGGGGCTTCGTTGCAACTACAGATAACATCATTCCGCCTCGTTCAAATACC
CCCTCAGGTCCCGGTCATTCTGCAACACCAGACACCCTTCCGCCTCGTGCAAACACCCCTCCAGTCCCAGGTCTT
CTTGCCTCTGGCAGCCAATCTGATACAAAACCCGCCAAACCCGTGGGGCTCCGGCGAAGTCAGCACTTGAGTTTG
AACTTAGGGAAGCCCATAGGACCGGATCCAGGACAGAATACAGACCAGGATGCCACCATGTGCAGCGATCCGCCG
AAGCCACCATTCTGGAGACGAATGTCATCTAATACAAGATCGCAGGGTGTACGCGAGGCTGACCAATATCCACTG
ACTGCACCCGAAACGCCTGCAACTCATGCCACCTATCGTGACTTCGAGAAATCCGAGAACGAAAAACACGAGCAT
GCTCGAAAGGAGGGAGACGAAATAGAAGGGGAAAGATACCCTATCGCCTATAACGAAAATTTCGAAAATGAAGAC
TACGGAGAGCCGCTGTGGAAAGAATACATCCGGCCGAAGGACCGAGATACCATGCGTCTACCCATATTTGGCTGG
AGTTGGATGCCTTCGATCTGGCTTCTAGGGGAAAAGGTTGACACCATCGATTATTGTCGAAAGGAGCTCGCTCGT
CTGAATCTGGAGATCGAAGTCGATCAGCAGCACCCCGAGGGGTTCCCTTTAATGAACTCGGCCTTCATCCAGTTC
AATCACCAAGTCGCTGCCCACATGGCCTGTCAAGCTGTCAGTCACCATCTCCCCAAGCAGATGGCACCCCGAGTC
GTGGAAATATCTCCCGATGATGTGATTTGGGATAATATGTCGATCAAGTGGTGGGAACGGTACCTGCGTTCCTTC
GGCATCATCACACTAGTTTGCGCAATGGTCGTTGGATGGGCGTTCCCCGTCGCCTTCACCGGACTACTATCACAA
TTGGCATATCTGGAGGGTGCATTTCCATGGCTTGCCTGGCTTGGCAAGCTTCCAGACTGGTTCATTTCTGCCATC
CAGGGTATTCTTCCTGCGCTGTGTTTAGCTATTCTGATGGCGCTGCTCCCTCTCATCCTTCGCTTTTTGAGCCGC
ACGCAAGGCCTCTTCACCGGCATGTCCATCGAGCTCACTGTCCAGAACTATTATTTTGCATTCCTCTTTGTGCAA
TTGTTCTTGGTTGTCACCATCGCTTCCAGTTTCTCGACGATCATTGAGAATGTCACTGATGTAACCAGCTGGCCA
CAACTCCTAGCAGTGAACATCCCGAAGTCTAGTAACTACTTCTTCTCTTACATGATTCTACAAGCCATGTCTGTG
AGCGCTGGCGCCCTTGTACAAATCTTTGGCCTGGTGAGCTGGTTCATTCTAGCTCCAATTTTGGACTCTACTGCC
CGGAAGAAGTGGGCACGAACAACAAACCTCAATCAGATGCAATGGGGTACATTCTTCCCTGTCTATACCACCCTA
GCCTCTATTGGTTTGATCTACTGTGTGATCGCACCTCTGATTCTAATTTTCAACATCCTCACCTTCGGCCTTTTC
TGGTTCGTCTATCGCTACAACACACTCTATGTGACTAAGTTTCGATTTGACACCGGTGGCCTTCTTTTTCCTCGA
GCTATTAATCAGCTATTCACGGGAATCTACGTTATGGAAGTCTGCCTAATCGGCTTGTTCTTCTTGGTTCGGAAC
GCGGATGACGATGTCGCCTGCAAGGGACAGGCTATTTGCATGATTGTTGTTCTAGTTTTGACGGCCGGTTACCAA
ATTCTTCTCAACGATGCGTTCAATCCACTGATCCGGTATCTGCCCGTTACCTTGGAAGATGATGCTGTTCGACGT
GATGAAGAGTTTCGTCGTGCTCAGCACGCTCGCCTCGGTCTCGCTCTTGACGATGACGATGACGAGGATGGTGAT
ATCGAAGGCTCCCTCGCCAAGCGTGAACAAGAAGAGCGCCGGCACGGAAAGGAGATAAAGGAGATGCAAGAAGAC
ATCGAGCTGAAACCTCTGGAGACCAATTTCCCAAACCAGATGCGACAAAACTCGGATATCTTGTCAGCACCCAAG
CTTGGAGACAAACGTCCATCATGGGCCTCCAGCTCATCAAACCGGAAATCTAAATTTTTCGGTCAGAACTCAGCA
ACCTCCACACCAACACTACGTGATATGCGGGAAAAGATGGCCCAAGACACCGAGGCCCAGGCACCAGCCCCCAGC
ACAGTCGGCCAAGCCCTCTTTGCCGGTATTCACGACGAATTAGAGGATCTTACGCCCGATGAGCGTGACCAGCTG
GTGCAACGTGCCTTCCAGCACGAGGCCCTTCGCGCCAAGCGGCCTGTCATCTGGATTCCGCGTGATGATCTGGGT
GTGAGTGATGACGAAGTGTACCGAACACAACGGTTTAGCAAACATATATGGATCAGCAATGAGTACCAGGCGCTA
GACGGCAAATGTCGGACGATCTTCAGTCGCAGTCCTCCAGATTTCTCGGAGGTGGATTTGATTCAGCTGTGA
Gene >Pro_DTO377G3_2|g7977.t1
ATGACTTCGGGCTTGGAGGAGGCGCTGGAACACACTGGCGGCCACGGCCGAACCGCCGAAGGTGTGTCAATCTCG
ACCTTCCTGGCGTCGCTGGCGACGGCCATTGTCGTTTTCGTCGTTGAATTTCTCCTCTTTCTGTTACTAAAAGGT
AAACTAAGCCGTATATAGTAAGTCCCCTGAAACCCCACTGGAAAGGAGAACGTGGACGTTGGACTGACCGAAATT
GATATCCAGTCAACCGCGAACCTATCTGGTACCAGATAGAGAACGCACAACCCCATCTCCGCCAGGCCTCTTCCA
TTGGATTGTCCCAGTCTTTCGTACATCCAGCTCGGAATTCATCCAGAAATGTGGGCTTGATGCATACTTCTTCCT
GCGCTATCTGCGCATGCTTTTGAAGATCTTCCTTCCTCTGGGCCTCGTGATATTACCTGTTCTACTTCCAATAAA
CCGTGCTGGTGGCAAGGGCCAGACATACGAAAATGGTACCTCAGGCACTAGATATTCCGTCACTGGTCTGGACCA
GTTGGCATGGGGTAACGTAACCCCTGAGCACACGAGTCGGTATTGGGCTCATTTGGTAATGGCCGTGATTGCCAT
TATCTATGTCTGTGCTGTGTTTTTTGATGAACTTCGGAATTACATTCGCCTGCGACAGGCCTACTTGACGTCTCC
CCAGCATCGACTCCGTGCTTCTGCTACCACTGTGCTCGTTACTTCTATTCCACCTGATTGGCTCACCATGGATGC
CCTTGACAGGCTTTTCGATGTTTTCCCTGGAGGTGTGCGAAACATTTGGCTCAACCGCAACTTCGACGACTTGAA
CGAGAAAGTGAAAGCACGAAACCATCTTGCTCTCAAGCTTGAAAGCGCCGAGACAGAATTGATTGCAAAATGCAA
AAAGGCACAGCTCAAAAAGGCCAAGGCGGAGGCAAAGAAGGCCGGCGAGAGTCAATCAAGTGCAGAGAAAAAAGA
GCAAAAGACGGCTGAAAAACGGGCATCTCAAATGGCTATGGGTCCTGGTATCAGCTCTGGTAATCCTCATCAGGC
CCATACAGTACAAGAAATGCTCCACAGAAAACCCCAAGAGAAACGGTCGGAGGACGGACCTCGAATGTTTGACCC
TGCCCTTGCCGCCGCCGGGGCGGTTGGCCAAGGGGTAGGGAAACTGGGCAAAACAGTGCTTGGAGGCTTCAAGAA
ACCGTTATCTCGAACTGGGGGCTTCGTTGCAACTACAGATAACATCATTCCGCCTCGTTCAAATACCCCCTCAGG
TCCCGGTCATTCTGCAACACCAGACACCCTTCCGCCTCGTGCAAACACCCCTCCAGTCCCAGGTCTTCTTGCCTC
TGGCAGCCAATCTGATACAAAACCCGCCAAACCCGTGGGGCTCCGGCGAAGTCAGCACTTGAGTTTGAACTTAGG
GAAGCCCATAGGACCGGATCCAGGACAGAATACAGACCAGGATGCCACCATGTGCAGCGATCCGCCGAAGCCACC
ATTCTGGAGACGAATGTCATCTAATACAAGATCGCAGGGTGTACGCGAGGCTGACCAATATCCACTGACTGCACC
CGAAACGCCTGCAACTCATGCCACCTATCGTGACTTCGAGAAATCCGAGAACGAAAAACACGAGCATGCTCGAAA
GGAGGGAGACGAAATAGAAGGGGAAAGATACCCTATCGCCTATAACGAAAATTTCGAAAATGAAGACTACGGAGA
GCCGCTGTGGAAAGAATACATCCGGCCGAAGGACCGAGATACCATGCGTCTACCCATATTTGGCTGGAGTTGGAT
GCCTTCGATCTGGCTTCTAGGGGAAAAGGTTGACACCATCGATTATTGTCGAAAGGAGCTCGCTCGTCTGAATCT
GGAGATCGAAGTCGATCAGCAGCACCCCGAGGGGTTCCCTTTAATGAACTCGGCCTTCATCCAGTTCAATCACCA
AGTCGCTGCCCACATGGCCTGTCAAGCTGTCAGTCACCATCTCCCCAAGCAGATGGCACCCCGAGTCGTGGAAAT
ATCTCCCGATGATGTGATTTGGGATAATATGTCGATCAAGTGGTGGGAACGGTACCTGCGTTCCTTCGGCATCAT
CACACTAGTTTGCGCAATGGTCGTTGGATGGGCGTTCCCCGTCGCCTTCACCGGACTACTATCACAATTGGCATA
TCTGGAGGGTGCATTTCCATGGCTTGCCTGGCTTGGCAAGCTTCCAGACTGGTTCATTTCTGCCATCCAGGGTAT
TCTTCCTGCGCTGTGTTTAGCTATTCTGATGGCGCTGCTCCCTCTCATCCTTCGCTTTTTGAGCCGCACGCAAGG
CCTCTTCACCGGCATGTCCATCGAGCTCACTGTCCAGAACTATTATTTTGCATTCCTCTTTGTGCAATTGTTCTT
GGTTGTCACCATCGCTTCCAGTTTCTCGACGATCATTGAGAATGTCACTGATGTAACCAGCTGGCCACAACTCCT
AGCAGTGAACATCCCGAAGTCTAGTAACTACTTCTTCTCTTACATGATTCTACAAGCCATGTCTGTGAGCGCTGG
CGCCCTTGTACAAATCTTTGGCCTGGTGAGCTGGTTCATTCTAGCTCCAATTTTGGACTCTACTGCCCGGAAGAA
GTGGGCACGAACAACAAACCTCAATCAGATGCAATGGGGTACATTCTTCCCTGTCTATACCACCCTAGCCTCTAT
TGGTAAGTCGTCTTGTCTTTTTTGATACAATCCGTTGATTAACATTCTCCAAGGTTTGATCTACTGTGTGATCGC
ACCTCTGATTCTAATTTTCAACATCCTCACCTTCGGCCTTTTCTGGTTCGTCTATCGCTACAACACACTCTATGT
GACTAAGTTTCGATTTGACACCGGTGGCCTTCTTTTTCCTCGAGCTATTAATCAGCTATTCACGGGAATCTACGT
TATGGAAGTCTGCCTAATCGGCTTGTTCTTCTTGGTTCGGAACGCGGATGACGATGTCGCCTGCAAGGGACAGGC
TATTTGCATGATTGTTGTTCTAGTTTTGACGGCCGGTTACCAAATTCTTCTCAACGATGCGTTCAATCCACTGAT
CCGGTATCTGCCCGTTACCTTGGAAGATGATGCTGTTCGACGTGATGAAGAGTTTCGTCGTGCTCAGCACGCTCG
CCTCGGTCTCGCTCTTGACGATGACGATGACGAGGATGGTGATATCGAAGGCTCCCTCGCCAAGCGTGAACAAGA
AGAGCGCCGGCACGGAAAGGAGATAAAGGAGATGCAAGAAGACATCGAGCTGAAACCTCTGGAGACCAATTTCCC
AAACCAGATGCGACAAAACTCGGATATCTTGTCAGCACCCAAGCTTGGAGACAAACGTCCATCATGGGCCTCCAG
CTCATCAAACCGGAAATCTAAATTTTTCGGTCAGAACTCAGCAACCTCCACACCAACACTACGTGATATGCGGGA
AAAGATGGCCCAAGACACCGAGGCCCAGGCACCAGCCCCCAGCACAGTCGGCCAAGCCCTCTTTGCCGGTATTCA
CGACGAATTAGAGGATCTTACGCCCGATGAGCGTGACCAGCTGGTGCAACGTGCCTTCCAGCACGAGGCCCTTCG
CGCCAAGCGGCCTGTCATCTGGATTCCGCGTGATGATCTGGGTGTGAGTGATGACGAAGTGTACCGAACACAACG
GTTTAGCAAACATATATGGATCAGCAATGAGTACCAGGCGCTAGACGGCAAATGTCGGACGATCTTCAGTCGCAG
TCCTCCAGATTTCTCGGAGGTGGATTTGATTCAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail