Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7971.t1
Gene name
Locationscaffold_28:8775..13699
Strand-
Gene length (bp)4924
Transcript length (bp)4869
Coding sequence length (bp)4869
Protein length (aa) 1623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13832 zf-HC5HC2H_2 PHD-zinc-finger like domain 4.8E-22 1064 1146
PF13771 zf-HC5HC2H PHD-like zinc-binding domain 2.9E-20 1074 1180
PF01426 BAH BAH domain 2.3E-14 178 287
PF00628 PHD PHD-finger 6.8E-07 944 990
PF13831 PHD_2 PHD-finger 1.8E-08 958 988

GO

GO Term Description Terminal node
GO:0003682 chromatin binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7971.t1
MTTPNSPEAVADSANGSATAYGTRSRGRNAPRPNYAEDRDLDADIDLSAPNSKSAKRNSGVALNHIVNGANHEEK
TSSAQPRKSLTNGQSANGSAKDAIPGTSSFSARPDDVNGSNLRKRKQPASTPHSTPNSGGAVKKIFTTPPGDSEG
GYFTNMMSFENSGPYLQDGQLIADDGTTFALNDHVYLICEPPGEPYYLARIMEFLPSKTKPGGFIEAMRVNWYYR
PRDIQRHSPDTRFLFASMHSDTCPLSSLRGKCDIRHVSEIEDLSCYKKTRNCFWYDKMFDRYIHRLYDVIPTKDI
INVPGNVKKVLDERWKFILVEIGKGKELTGAVKTCKRCHLYAATSESVDCAVCNSTYHMHCVRPALTKKPARGFA
WACAACSRAQERKLEARNTPLTGGIRTDGEDVIMEEEEEEDPNNVANGIANGTSASTPAAEEDSMPQPATAEQIA
QAKMWPYRYLGIHCRVEDALDYDDRIYPRASSRLGTRHQAVVPAWPGRPVEYVKPLETKKKSKVPGKKDGKLSKD
AQAAMEAAKHERANRPKWVQDEPVGYVHRGQDEPIIINGKQTRTAELQFKMPSSDQITARGEDDAPGSHLSDADR
EKFVDDYMRQAKELAPGIGVEKYSTNFLDRALALLYSENFDVQAALAKLKKTNKYKDLKEPHIRPEELKLFEQGV
AKYGSEWRNIMKHVKTVHIYQIVRFYYMWKKTASGRKIWGSYEGRRGKKEVRRHSVVSSKLLDDVADDQDDSAFD
SEKAIVQKRGFHCKFCSIRHSRQWRRAPLVPPGTVVPSEPSNKKDKGPMLTVALCLRCALLWRKYGIQYEDVDEV
AKRIAGSGNKSWRRRIDEEMLAQLIVATETPFVITPATATTATAMGIPLDTNPRLLMEGKPEGKVEGKVEPTKKK
AKETPAPSTATSVEPMPKRKTIPEKVVEAPPIVPDPPKAKTLPCSICNQIEPSGEEHLSCRDCRLTVHRNCYGVR
DSRPSSKWLCDMCSNDRTPSISTDYTCVLCPVSWTEHDLMETPKNNSRKKTERDKEKERMEKEMVAEAIKLYRQR
QEAVGKPIGPREPLKRTAGNNWAHVLCTLWTPELKYGDAEELEPAEGFGSIPKERWRETCKVCKSNKGACVPCSF
AGCNAHFHVGCAFQARYRFGFDITPVKSSRRDSMRAIRLGEDIGAATPAVYCPNHHVSTVLHEIGEQTNQHHLNA
LQLFAQTYKQADLTLTGTVRKAAYMHQSVGAPPHPSTNVNRRASTSTTPASRDTHKVQPVEDVAGDPMDIDTDNH
VASRPVAPGVETNRKCVRCATGFSPRWWAIGRRPPMANGSGHPHHPPQGPFPQQNGDPCEMAYECHKCHLKNPAP
PPPPPVPEPTPDQRPSPYSAQRPMIPTSRMPGHPGHPGHPGHTFLPHPHPHPHPHPPPNGVLGRPMPPAHPSNGL
PGPGYTGPYEQRHTPDIGIRNGMSPSPYPPAQPPPHHMNNYPPPHPAGPLPQHYTSAGPSGPPPPYSTHQSPYGP
VPARSPHLSQPPPRSYAASASPPIVQATTINRSPQTSLSALNGGPPPRMYSVERVVGAPSHSPPVTQARIDPRGP
TATPPTRPEDTPPSLMGGPPSSRHSGVNGTAPGTGASASPSLKNLLS*
Coding >Pro_DTO377G3_2|g7971.t1
ATGACCACTCCCAACTCTCCGGAGGCAGTGGCCGATTCGGCCAACGGCTCCGCCACCGCGTATGGCACGCGATCG
AGAGGTCGTAATGCCCCTCGGCCAAATTACGCCGAGGACCGTGACCTGGATGCGGACATCGATCTCTCTGCTCCA
AACTCCAAGTCCGCCAAAAGAAATAGCGGCGTGGCACTCAACCACATTGTCAACGGCGCCAATCACGAGGAGAAG
ACCTCGTCGGCGCAACCACGAAAGAGCCTGACCAATGGTCAGAGCGCAAATGGATCGGCAAAAGATGCCATTCCT
GGCACTTCTTCATTTTCCGCCAGACCGGATGATGTGAATGGATCTAATTTGAGAAAACGCAAACAACCCGCCAGC
ACGCCACATTCCACCCCCAACTCGGGTGGTGCCGTGAAGAAGATCTTCACCACCCCTCCAGGCGATTCGGAAGGG
GGTTATTTCACCAACATGATGAGTTTCGAAAACTCTGGGCCCTATTTGCAGGATGGCCAATTAATAGCCGATGAT
GGCACCACTTTTGCCCTCAATGACCATGTTTATTTGATTTGCGAACCTCCGGGGGAGCCATATTATCTAGCGCGC
ATCATGGAATTTCTGCCATCCAAAACCAAGCCGGGTGGCTTCATTGAGGCAATGAGAGTCAACTGGTATTACCGC
CCACGGGATATCCAGCGCCATTCTCCCGACACTCGATTTCTCTTTGCTTCAATGCACTCTGACACCTGTCCTCTT
TCTTCACTACGGGGCAAGTGTGATATTCGACACGTGTCGGAGATTGAAGACCTTAGCTGTTACAAGAAGACGAGG
AACTGTTTCTGGTACGACAAAATGTTCGACCGATATATCCATCGTCTTTACGATGTCATTCCGACTAAAGATATC
ATTAATGTCCCGGGAAACGTCAAGAAAGTGCTCGACGAACGCTGGAAATTCATTCTGGTCGAGATCGGAAAGGGG
AAAGAATTGACGGGTGCCGTCAAGACTTGCAAGCGATGCCATTTATACGCCGCAACCTCTGAATCAGTTGACTGT
GCAGTTTGCAATTCAACATATCACATGCATTGTGTCCGACCCGCCTTGACAAAGAAACCCGCTCGAGGCTTTGCT
TGGGCTTGTGCCGCTTGCAGTCGCGCCCAGGAGCGCAAACTCGAGGCACGCAACACACCATTAACTGGCGGCATC
CGAACAGATGGCGAAGATGTGATCATGGAAGAAGAGGAGGAAGAGGATCCCAATAATGTGGCGAATGGCATAGCC
AACGGTACCTCCGCCAGTACCCCCGCAGCCGAGGAAGATTCCATGCCTCAACCCGCAACTGCGGAACAGATCGCA
CAAGCCAAAATGTGGCCTTACCGATACCTGGGTATTCACTGCCGCGTGGAGGATGCTCTGGATTACGATGATCGA
ATTTACCCCCGAGCCAGCTCCCGTCTAGGAACTCGGCACCAGGCAGTGGTCCCCGCTTGGCCAGGCCGTCCAGTT
GAGTACGTGAAACCCCTTGAGACGAAAAAGAAATCAAAGGTTCCCGGCAAAAAGGATGGAAAGCTCTCTAAGGAT
GCACAGGCAGCAATGGAAGCTGCGAAGCACGAGAGGGCAAACCGACCGAAGTGGGTTCAAGATGAGCCAGTGGGC
TATGTGCATCGTGGTCAGGATGAGCCGATCATAATCAATGGAAAACAGACGCGCACAGCCGAGCTTCAATTCAAA
ATGCCCAGTTCTGATCAGATCACCGCCCGCGGCGAAGATGACGCACCTGGCTCCCATTTAAGCGATGCAGATCGA
GAAAAGTTCGTCGACGACTACATGCGCCAAGCCAAGGAACTAGCCCCTGGTATTGGGGTTGAGAAATACAGCACA
AATTTCCTCGACAGAGCCCTTGCACTTCTCTACTCTGAGAACTTCGATGTCCAGGCTGCCCTTGCTAAGCTGAAG
AAAACCAACAAGTACAAGGATCTTAAGGAGCCCCACATACGACCGGAGGAACTCAAGCTATTCGAACAAGGTGTC
GCCAAGTATGGATCCGAATGGCGCAATATCATGAAGCACGTCAAGACTGTCCATATCTATCAGATCGTCCGTTTC
TACTACATGTGGAAGAAAACCGCCAGCGGTCGGAAGATTTGGGGCAGTTATGAAGGCAGACGTGGCAAGAAGGAG
GTACGCCGTCATAGCGTAGTTTCATCTAAACTCCTTGACGACGTGGCCGATGATCAGGATGATTCCGCCTTTGAC
TCCGAGAAAGCCATTGTCCAGAAGCGTGGATTCCATTGCAAGTTCTGCTCTATTCGCCATTCGCGACAGTGGCGC
CGTGCGCCCCTAGTTCCCCCCGGCACCGTGGTTCCGTCCGAGCCCTCAAACAAGAAAGACAAGGGCCCTATGCTC
ACCGTTGCGCTCTGTCTTCGCTGCGCCCTCCTATGGCGGAAGTACGGGATTCAATATGAGGATGTTGACGAGGTT
GCAAAGAGGATTGCAGGCAGCGGTAACAAGTCATGGCGACGCCGAATCGACGAAGAAATGCTTGCGCAACTGATT
GTAGCTACCGAAACTCCGTTTGTCATCACCCCTGCTACGGCAACTACGGCTACTGCGATGGGCATTCCGCTTGAT
ACAAACCCTCGACTCTTGATGGAAGGAAAGCCGGAAGGAAAGGTGGAAGGAAAGGTGGAACCGACGAAAAAGAAG
GCCAAGGAAACGCCCGCTCCTTCAACTGCGACATCCGTTGAACCTATGCCAAAGAGGAAGACGATCCCGGAGAAA
GTGGTGGAAGCTCCACCGATTGTTCCCGACCCGCCAAAGGCCAAGACCCTCCCTTGTTCAATCTGCAACCAAATA
GAACCTTCAGGTGAAGAGCACCTTTCATGTCGGGATTGCCGTCTTACGGTCCATCGCAATTGCTATGGTGTGCGG
GATTCGCGCCCCAGCAGCAAGTGGCTGTGTGATATGTGCTCCAACGACCGCACTCCCTCGATTTCTACAGACTAC
ACATGTGTTCTTTGCCCAGTGTCATGGACCGAACACGACCTCATGGAGACGCCTAAGAACAACTCCCGGAAGAAG
ACTGAGCGTGACAAGGAAAAGGAGCGGATGGAGAAGGAGATGGTTGCGGAGGCGATTAAGCTTTATCGCCAGCGT
CAGGAGGCCGTTGGGAAGCCTATCGGTCCCCGGGAACCCCTGAAGCGTACTGCAGGCAACAACTGGGCCCACGTG
CTTTGCACCTTGTGGACCCCGGAGTTGAAGTATGGCGATGCAGAGGAGCTTGAGCCTGCGGAAGGATTCGGATCT
ATTCCCAAGGAGCGGTGGCGCGAGACGTGTAAGGTTTGCAAGTCAAATAAGGGTGCATGTGTACCATGTAGCTTT
GCTGGCTGCAATGCTCACTTCCACGTGGGCTGTGCTTTCCAAGCACGCTACCGGTTCGGCTTCGATATCACACCC
GTCAAGAGCTCACGCCGCGACAGCATGCGAGCTATTCGTCTCGGCGAAGATATTGGAGCAGCGACACCTGCTGTT
TACTGTCCAAATCACCATGTGTCCACTGTTCTGCACGAAATCGGTGAGCAGACAAACCAGCATCATCTAAACGCT
CTCCAATTGTTCGCCCAGACCTACAAGCAGGCCGACCTCACCCTCACTGGAACCGTTCGCAAAGCGGCGTACATG
CATCAATCCGTCGGAGCTCCGCCACACCCTTCCACCAATGTCAACCGCCGGGCTTCAACGAGTACTACGCCGGCT
TCCAGGGATACCCACAAAGTTCAGCCGGTGGAGGATGTGGCTGGAGATCCCATGGATATTGATACCGACAACCAT
GTTGCATCGCGACCGGTTGCTCCTGGCGTGGAGACCAACCGCAAATGCGTTCGTTGTGCCACCGGCTTTAGTCCT
AGGTGGTGGGCTATTGGGCGACGACCTCCTATGGCCAATGGCTCTGGACACCCTCATCATCCGCCCCAAGGTCCC
TTCCCCCAACAAAATGGAGATCCTTGCGAAATGGCATACGAATGTCATAAATGCCATTTGAAGAATCCGGCGCCT
CCTCCCCCTCCGCCTGTACCAGAGCCCACGCCCGACCAACGGCCTTCGCCTTACTCTGCTCAACGCCCCATGATA
CCCACCTCACGAATGCCTGGCCATCCAGGTCATCCAGGTCATCCAGGCCATACATTTTTGCCACACCCACATCCA
CACCCGCACCCGCATCCCCCCCCTAACGGTGTGCTTGGGCGGCCGATGCCTCCTGCTCACCCATCCAACGGACTT
CCCGGACCAGGATACACTGGACCATACGAGCAGCGTCACACGCCCGATATCGGTATTCGCAACGGCATGTCGCCG
TCTCCTTATCCCCCGGCACAGCCACCTCCCCATCACATGAATAACTACCCGCCACCCCATCCTGCAGGGCCATTA
CCTCAACACTATACCAGTGCTGGGCCTTCGGGACCTCCGCCACCATATTCCACCCACCAGAGCCCGTATGGCCCT
GTGCCGGCTCGCTCGCCGCATCTTTCGCAGCCACCGCCGCGATCATATGCAGCGTCCGCATCCCCTCCAATCGTG
CAAGCGACGACGATCAACCGATCACCCCAGACCTCGCTGAGCGCTCTCAACGGCGGTCCCCCTCCTCGCATGTAC
TCCGTTGAGCGTGTGGTAGGAGCCCCCTCTCACTCACCACCGGTGACGCAGGCACGCATTGACCCGCGGGGGCCC
ACCGCCACTCCTCCCACTCGACCGGAAGATACACCACCTTCCCTGATGGGCGGGCCACCAAGCAGTCGGCACTCT
GGGGTCAACGGTACAGCGCCCGGGACCGGAGCGAGCGCAAGCCCATCGCTGAAGAACCTTCTCTCATAA
Transcript >Pro_DTO377G3_2|g7971.t1
ATGACCACTCCCAACTCTCCGGAGGCAGTGGCCGATTCGGCCAACGGCTCCGCCACCGCGTATGGCACGCGATCG
AGAGGTCGTAATGCCCCTCGGCCAAATTACGCCGAGGACCGTGACCTGGATGCGGACATCGATCTCTCTGCTCCA
AACTCCAAGTCCGCCAAAAGAAATAGCGGCGTGGCACTCAACCACATTGTCAACGGCGCCAATCACGAGGAGAAG
ACCTCGTCGGCGCAACCACGAAAGAGCCTGACCAATGGTCAGAGCGCAAATGGATCGGCAAAAGATGCCATTCCT
GGCACTTCTTCATTTTCCGCCAGACCGGATGATGTGAATGGATCTAATTTGAGAAAACGCAAACAACCCGCCAGC
ACGCCACATTCCACCCCCAACTCGGGTGGTGCCGTGAAGAAGATCTTCACCACCCCTCCAGGCGATTCGGAAGGG
GGTTATTTCACCAACATGATGAGTTTCGAAAACTCTGGGCCCTATTTGCAGGATGGCCAATTAATAGCCGATGAT
GGCACCACTTTTGCCCTCAATGACCATGTTTATTTGATTTGCGAACCTCCGGGGGAGCCATATTATCTAGCGCGC
ATCATGGAATTTCTGCCATCCAAAACCAAGCCGGGTGGCTTCATTGAGGCAATGAGAGTCAACTGGTATTACCGC
CCACGGGATATCCAGCGCCATTCTCCCGACACTCGATTTCTCTTTGCTTCAATGCACTCTGACACCTGTCCTCTT
TCTTCACTACGGGGCAAGTGTGATATTCGACACGTGTCGGAGATTGAAGACCTTAGCTGTTACAAGAAGACGAGG
AACTGTTTCTGGTACGACAAAATGTTCGACCGATATATCCATCGTCTTTACGATGTCATTCCGACTAAAGATATC
ATTAATGTCCCGGGAAACGTCAAGAAAGTGCTCGACGAACGCTGGAAATTCATTCTGGTCGAGATCGGAAAGGGG
AAAGAATTGACGGGTGCCGTCAAGACTTGCAAGCGATGCCATTTATACGCCGCAACCTCTGAATCAGTTGACTGT
GCAGTTTGCAATTCAACATATCACATGCATTGTGTCCGACCCGCCTTGACAAAGAAACCCGCTCGAGGCTTTGCT
TGGGCTTGTGCCGCTTGCAGTCGCGCCCAGGAGCGCAAACTCGAGGCACGCAACACACCATTAACTGGCGGCATC
CGAACAGATGGCGAAGATGTGATCATGGAAGAAGAGGAGGAAGAGGATCCCAATAATGTGGCGAATGGCATAGCC
AACGGTACCTCCGCCAGTACCCCCGCAGCCGAGGAAGATTCCATGCCTCAACCCGCAACTGCGGAACAGATCGCA
CAAGCCAAAATGTGGCCTTACCGATACCTGGGTATTCACTGCCGCGTGGAGGATGCTCTGGATTACGATGATCGA
ATTTACCCCCGAGCCAGCTCCCGTCTAGGAACTCGGCACCAGGCAGTGGTCCCCGCTTGGCCAGGCCGTCCAGTT
GAGTACGTGAAACCCCTTGAGACGAAAAAGAAATCAAAGGTTCCCGGCAAAAAGGATGGAAAGCTCTCTAAGGAT
GCACAGGCAGCAATGGAAGCTGCGAAGCACGAGAGGGCAAACCGACCGAAGTGGGTTCAAGATGAGCCAGTGGGC
TATGTGCATCGTGGTCAGGATGAGCCGATCATAATCAATGGAAAACAGACGCGCACAGCCGAGCTTCAATTCAAA
ATGCCCAGTTCTGATCAGATCACCGCCCGCGGCGAAGATGACGCACCTGGCTCCCATTTAAGCGATGCAGATCGA
GAAAAGTTCGTCGACGACTACATGCGCCAAGCCAAGGAACTAGCCCCTGGTATTGGGGTTGAGAAATACAGCACA
AATTTCCTCGACAGAGCCCTTGCACTTCTCTACTCTGAGAACTTCGATGTCCAGGCTGCCCTTGCTAAGCTGAAG
AAAACCAACAAGTACAAGGATCTTAAGGAGCCCCACATACGACCGGAGGAACTCAAGCTATTCGAACAAGGTGTC
GCCAAGTATGGATCCGAATGGCGCAATATCATGAAGCACGTCAAGACTGTCCATATCTATCAGATCGTCCGTTTC
TACTACATGTGGAAGAAAACCGCCAGCGGTCGGAAGATTTGGGGCAGTTATGAAGGCAGACGTGGCAAGAAGGAG
GTACGCCGTCATAGCGTAGTTTCATCTAAACTCCTTGACGACGTGGCCGATGATCAGGATGATTCCGCCTTTGAC
TCCGAGAAAGCCATTGTCCAGAAGCGTGGATTCCATTGCAAGTTCTGCTCTATTCGCCATTCGCGACAGTGGCGC
CGTGCGCCCCTAGTTCCCCCCGGCACCGTGGTTCCGTCCGAGCCCTCAAACAAGAAAGACAAGGGCCCTATGCTC
ACCGTTGCGCTCTGTCTTCGCTGCGCCCTCCTATGGCGGAAGTACGGGATTCAATATGAGGATGTTGACGAGGTT
GCAAAGAGGATTGCAGGCAGCGGTAACAAGTCATGGCGACGCCGAATCGACGAAGAAATGCTTGCGCAACTGATT
GTAGCTACCGAAACTCCGTTTGTCATCACCCCTGCTACGGCAACTACGGCTACTGCGATGGGCATTCCGCTTGAT
ACAAACCCTCGACTCTTGATGGAAGGAAAGCCGGAAGGAAAGGTGGAAGGAAAGGTGGAACCGACGAAAAAGAAG
GCCAAGGAAACGCCCGCTCCTTCAACTGCGACATCCGTTGAACCTATGCCAAAGAGGAAGACGATCCCGGAGAAA
GTGGTGGAAGCTCCACCGATTGTTCCCGACCCGCCAAAGGCCAAGACCCTCCCTTGTTCAATCTGCAACCAAATA
GAACCTTCAGGTGAAGAGCACCTTTCATGTCGGGATTGCCGTCTTACGGTCCATCGCAATTGCTATGGTGTGCGG
GATTCGCGCCCCAGCAGCAAGTGGCTGTGTGATATGTGCTCCAACGACCGCACTCCCTCGATTTCTACAGACTAC
ACATGTGTTCTTTGCCCAGTGTCATGGACCGAACACGACCTCATGGAGACGCCTAAGAACAACTCCCGGAAGAAG
ACTGAGCGTGACAAGGAAAAGGAGCGGATGGAGAAGGAGATGGTTGCGGAGGCGATTAAGCTTTATCGCCAGCGT
CAGGAGGCCGTTGGGAAGCCTATCGGTCCCCGGGAACCCCTGAAGCGTACTGCAGGCAACAACTGGGCCCACGTG
CTTTGCACCTTGTGGACCCCGGAGTTGAAGTATGGCGATGCAGAGGAGCTTGAGCCTGCGGAAGGATTCGGATCT
ATTCCCAAGGAGCGGTGGCGCGAGACGTGTAAGGTTTGCAAGTCAAATAAGGGTGCATGTGTACCATGTAGCTTT
GCTGGCTGCAATGCTCACTTCCACGTGGGCTGTGCTTTCCAAGCACGCTACCGGTTCGGCTTCGATATCACACCC
GTCAAGAGCTCACGCCGCGACAGCATGCGAGCTATTCGTCTCGGCGAAGATATTGGAGCAGCGACACCTGCTGTT
TACTGTCCAAATCACCATGTGTCCACTGTTCTGCACGAAATCGGTGAGCAGACAAACCAGCATCATCTAAACGCT
CTCCAATTGTTCGCCCAGACCTACAAGCAGGCCGACCTCACCCTCACTGGAACCGTTCGCAAAGCGGCGTACATG
CATCAATCCGTCGGAGCTCCGCCACACCCTTCCACCAATGTCAACCGCCGGGCTTCAACGAGTACTACGCCGGCT
TCCAGGGATACCCACAAAGTTCAGCCGGTGGAGGATGTGGCTGGAGATCCCATGGATATTGATACCGACAACCAT
GTTGCATCGCGACCGGTTGCTCCTGGCGTGGAGACCAACCGCAAATGCGTTCGTTGTGCCACCGGCTTTAGTCCT
AGGTGGTGGGCTATTGGGCGACGACCTCCTATGGCCAATGGCTCTGGACACCCTCATCATCCGCCCCAAGGTCCC
TTCCCCCAACAAAATGGAGATCCTTGCGAAATGGCATACGAATGTCATAAATGCCATTTGAAGAATCCGGCGCCT
CCTCCCCCTCCGCCTGTACCAGAGCCCACGCCCGACCAACGGCCTTCGCCTTACTCTGCTCAACGCCCCATGATA
CCCACCTCACGAATGCCTGGCCATCCAGGTCATCCAGGTCATCCAGGCCATACATTTTTGCCACACCCACATCCA
CACCCGCACCCGCATCCCCCCCCTAACGGTGTGCTTGGGCGGCCGATGCCTCCTGCTCACCCATCCAACGGACTT
CCCGGACCAGGATACACTGGACCATACGAGCAGCGTCACACGCCCGATATCGGTATTCGCAACGGCATGTCGCCG
TCTCCTTATCCCCCGGCACAGCCACCTCCCCATCACATGAATAACTACCCGCCACCCCATCCTGCAGGGCCATTA
CCTCAACACTATACCAGTGCTGGGCCTTCGGGACCTCCGCCACCATATTCCACCCACCAGAGCCCGTATGGCCCT
GTGCCGGCTCGCTCGCCGCATCTTTCGCAGCCACCGCCGCGATCATATGCAGCGTCCGCATCCCCTCCAATCGTG
CAAGCGACGACGATCAACCGATCACCCCAGACCTCGCTGAGCGCTCTCAACGGCGGTCCCCCTCCTCGCATGTAC
TCCGTTGAGCGTGTGGTAGGAGCCCCCTCTCACTCACCACCGGTGACGCAGGCACGCATTGACCCGCGGGGGCCC
ACCGCCACTCCTCCCACTCGACCGGAAGATACACCACCTTCCCTGATGGGCGGGCCACCAAGCAGTCGGCACTCT
GGGGTCAACGGTACAGCGCCCGGGACCGGAGCGAGCGCAAGCCCATCGCTGAAGAACCTTCTCTCATAA
Gene >Pro_DTO377G3_2|g7971.t1
ATGACCACTCCCAACTCTCCGGAGGCAGTGGCCGATTCGGCCAACGGCTCCGCCACCGCGTATGGCACGCGATCG
AGAGGTCGTAATGCCCCTCGGCCAAATTACGCCGAGGACCGTGACCTGGATGCGGACATCGATCTCTCTGCTCCA
AACTCCAAGTCCGCCAAAAGAAATAGCGGCGTGGCACTCAACCACATTGTCAACGGCGCCAATCACGAGGAGAAG
ACCTCGTCGGCGCAACCACGAAAGAGCCTGACCAATGGTCAGAGCGCAAATGGATCGGCAAAAGATGCCATTCCT
GGCACTTCTTCATTTTCCGCCAGACCGGATGATGTGAATGGATCTAATTTGAGAAAACGCAAACAACCCGCCAGC
ACGCCACATTCCACCCCCAACTCGGGTGGTGCCGTGAAGAAGATCTTCACCACCCCTCCAGGCGATTCGGAAGGG
GGTTATTTCACCAACATGATGAGTTTCGAAAACTCTGGGCCCTATTTGCAGGATGGCCAATTAATAGCCGATGAT
GGCACCACTTTTGCCCTCAATGGTTAGCCCCTCACTTCCTTCAAAAGTGATTGTTCCAAGACTAATAATTTTTAT
AGACCATGTTTATTTGATTTGCGAACCTCCGGGGGAGCCATATTATCTAGCGCGCATCATGGAATTTCTGCCATC
CAAAACCAAGCCGGGTGGCTTCATTGAGGCAATGAGAGTCAACTGGTATTACCGCCCACGGGATATCCAGCGCCA
TTCTCCCGACACTCGATTTCTCTTTGCTTCAATGCACTCTGACACCTGTCCTCTTTCTTCACTACGGGGCAAGTG
TGATATTCGACACGTGTCGGAGATTGAAGACCTTAGCTGTTACAAGAAGACGAGGAACTGTTTCTGGTACGACAA
AATGTTCGACCGATATATCCATCGTCTTTACGATGTCATTCCGACTAAAGATATCATTAATGTCCCGGGAAACGT
CAAGAAAGTGCTCGACGAACGCTGGAAATTCATTCTGGTCGAGATCGGAAAGGGGAAAGAATTGACGGGTGCCGT
CAAGACTTGCAAGCGATGCCATTTATACGCCGCAACCTCTGAATCAGTTGACTGTGCAGTTTGCAATTCAACATA
TCACATGCATTGTGTCCGACCCGCCTTGACAAAGAAACCCGCTCGAGGCTTTGCTTGGGCTTGTGCCGCTTGCAG
TCGCGCCCAGGAGCGCAAACTCGAGGCACGCAACACACCATTAACTGGCGGCATCCGAACAGATGGCGAAGATGT
GATCATGGAAGAAGAGGAGGAAGAGGATCCCAATAATGTGGCGAATGGCATAGCCAACGGTACCTCCGCCAGTAC
CCCCGCAGCCGAGGAAGATTCCATGCCTCAACCCGCAACTGCGGAACAGATCGCACAAGCCAAAATGTGGCCTTA
CCGATACCTGGGTATTCACTGCCGCGTGGAGGATGCTCTGGATTACGATGATCGAATTTACCCCCGAGCCAGCTC
CCGTCTAGGAACTCGGCACCAGGCAGTGGTCCCCGCTTGGCCAGGCCGTCCAGTTGAGTACGTGAAACCCCTTGA
GACGAAAAAGAAATCAAAGGTTCCCGGCAAAAAGGATGGAAAGCTCTCTAAGGATGCACAGGCAGCAATGGAAGC
TGCGAAGCACGAGAGGGCAAACCGACCGAAGTGGGTTCAAGATGAGCCAGTGGGCTATGTGCATCGTGGTCAGGA
TGAGCCGATCATAATCAATGGAAAACAGACGCGCACAGCCGAGCTTCAATTCAAAATGCCCAGTTCTGATCAGAT
CACCGCCCGCGGCGAAGATGACGCACCTGGCTCCCATTTAAGCGATGCAGATCGAGAAAAGTTCGTCGACGACTA
CATGCGCCAAGCCAAGGAACTAGCCCCTGGTATTGGGGTTGAGAAATACAGCACAAATTTCCTCGACAGAGCCCT
TGCACTTCTCTACTCTGAGAACTTCGATGTCCAGGCTGCCCTTGCTAAGCTGAAGAAAACCAACAAGTACAAGGA
TCTTAAGGAGCCCCACATACGACCGGAGGAACTCAAGCTATTCGAACAAGGTGTCGCCAAGTATGGATCCGAATG
GCGCAATATCATGAAGCACGTCAAGACTGTCCATATCTATCAGATCGTCCGTTTCTACTACATGTGGAAGAAAAC
CGCCAGCGGTCGGAAGATTTGGGGCAGTTATGAAGGCAGACGTGGCAAGAAGGAGGTACGCCGTCATAGCGTAGT
TTCATCTAAACTCCTTGACGACGTGGCCGATGATCAGGATGATTCCGCCTTTGACTCCGAGAAAGCCATTGTCCA
GAAGCGTGGATTCCATTGCAAGTTCTGCTCTATTCGCCATTCGCGACAGTGGCGCCGTGCGCCCCTAGTTCCCCC
CGGCACCGTGGTTCCGTCCGAGCCCTCAAACAAGAAAGACAAGGGCCCTATGCTCACCGTTGCGCTCTGTCTTCG
CTGCGCCCTCCTATGGCGGAAGTACGGGATTCAATATGAGGATGTTGACGAGGTTGCAAAGAGGATTGCAGGCAG
CGGTAACAAGTCATGGCGACGCCGAATCGACGAAGAAATGCTTGCGCAACTGATTGTAGCTACCGAAACTCCGTT
TGTCATCACCCCTGCTACGGCAACTACGGCTACTGCGATGGGCATTCCGCTTGATACAAACCCTCGACTCTTGAT
GGAAGGAAAGCCGGAAGGAAAGGTGGAAGGAAAGGTGGAACCGACGAAAAAGAAGGCCAAGGAAACGCCCGCTCC
TTCAACTGCGACATCCGTTGAACCTATGCCAAAGAGGAAGACGATCCCGGAGAAAGTGGTGGAAGCTCCACCGAT
TGTTCCCGACCCGCCAAAGGCCAAGACCCTCCCTTGTTCAATCTGCAACCAAATAGAACCTTCAGGTGAAGAGCA
CCTTTCATGTCGGGATTGCCGTCTTACGGTCCATCGCAATTGCTATGGTGTGCGGGATTCGCGCCCCAGCAGCAA
GTGGCTGTGTGATATGTGCTCCAACGACCGCACTCCCTCGATTTCTACAGACTACACATGTGTTCTTTGCCCAGT
GTCATGGACCGAACACGACCTCATGGAGACGCCTAAGAACAACTCCCGGAAGAAGACTGAGCGTGACAAGGAAAA
GGAGCGGATGGAGAAGGAGATGGTTGCGGAGGCGATTAAGCTTTATCGCCAGCGTCAGGAGGCCGTTGGGAAGCC
TATCGGTCCCCGGGAACCCCTGAAGCGTACTGCAGGCAACAACTGGGCCCACGTGCTTTGCACCTTGTGGACCCC
GGAGTTGAAGTATGGCGATGCAGAGGAGCTTGAGCCTGCGGAAGGATTCGGATCTATTCCCAAGGAGCGGTGGCG
CGAGACGTGTAAGGTTTGCAAGTCAAATAAGGGTGCATGTGTACCATGTAGCTTTGCTGGCTGCAATGCTCACTT
CCACGTGGGCTGTGCTTTCCAAGCACGCTACCGGTTCGGCTTCGATATCACACCCGTCAAGAGCTCACGCCGCGA
CAGCATGCGAGCTATTCGTCTCGGCGAAGATATTGGAGCAGCGACACCTGCTGTTTACTGTCCAAATCACCATGT
GTCCACTGTTCTGCACGAAATCGGTGAGCAGACAAACCAGCATCATCTAAACGCTCTCCAATTGTTCGCCCAGAC
CTACAAGCAGGCCGACCTCACCCTCACTGGAACCGTTCGCAAAGCGGCGTACATGCATCAATCCGTCGGAGCTCC
GCCACACCCTTCCACCAATGTCAACCGCCGGGCTTCAACGAGTACTACGCCGGCTTCCAGGGATACCCACAAAGT
TCAGCCGGTGGAGGATGTGGCTGGAGATCCCATGGATATTGATACCGACAACCATGTTGCATCGCGACCGGTTGC
TCCTGGCGTGGAGACCAACCGCAAATGCGTTCGTTGTGCCACCGGCTTTAGTCCTAGGTGGTGGGCTATTGGGCG
ACGACCTCCTATGGCCAATGGCTCTGGACACCCTCATCATCCGCCCCAAGGTCCCTTCCCCCAACAAAATGGAGA
TCCTTGCGAAATGGCATACGAATGTCATAAATGCCATTTGAAGAATCCGGCGCCTCCTCCCCCTCCGCCTGTACC
AGAGCCCACGCCCGACCAACGGCCTTCGCCTTACTCTGCTCAACGCCCCATGATACCCACCTCACGAATGCCTGG
CCATCCAGGTCATCCAGGTCATCCAGGCCATACATTTTTGCCACACCCACATCCACACCCGCACCCGCATCCCCC
CCCTAACGGTGTGCTTGGGCGGCCGATGCCTCCTGCTCACCCATCCAACGGACTTCCCGGACCAGGATACACTGG
ACCATACGAGCAGCGTCACACGCCCGATATCGGTATTCGCAACGGCATGTCGCCGTCTCCTTATCCCCCGGCACA
GCCACCTCCCCATCACATGAATAACTACCCGCCACCCCATCCTGCAGGGCCATTACCTCAACACTATACCAGTGC
TGGGCCTTCGGGACCTCCGCCACCATATTCCACCCACCAGAGCCCGTATGGCCCTGTGCCGGCTCGCTCGCCGCA
TCTTTCGCAGCCACCGCCGCGATCATATGCAGCGTCCGCATCCCCTCCAATCGTGCAAGCGACGACGATCAACCG
ATCACCCCAGACCTCGCTGAGCGCTCTCAACGGCGGTCCCCCTCCTCGCATGTACTCCGTTGAGCGTGTGGTAGG
AGCCCCCTCTCACTCACCACCGGTGACGCAGGCACGCATTGACCCGCGGGGGCCCACCGCCACTCCTCCCACTCG
ACCGGAAGATACACCACCTTCCCTGATGGGCGGGCCACCAAGCAGTCGGCACTCTGGGGTCAACGGTACAGCGCC
CGGGACCGGAGCGAGCGCAAGCCCATCGCTGAAGAACCTTCTCTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail