Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7964.t1
Gene name
Locationscaffold_27:277050..278871
Strand+
Gene length (bp)1821
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04083 Abhydro_lipase Partial alpha/beta-hydrolase lipase region 1.1E-20 176 263
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.6E-06 245 352

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 77 99 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7964.t1
MRDLQSDRIKPEKKENVGLMVGNSIAASAMDFTGTSSFREKKRSSGLNFLTAEHPLFPPMPSYGPPSALRRVQYY
AFIVASFFLSICFLTVIFIGALIHTAGVAISEARLRLSGHNPETMRSFYTEEQARRKARANVDRRWALRQQKRDM
DEEQGPEECQECPSLEGGKDPLVGDVAYYARRVGLDVETFRVQTEDGFIITLWHVYNPREYEALSPEERRERGPD
VFTKPRLSSTSRPQSNRRYPVLLIHGLLQNAGAFCTNDEDSLAFYLCKSGYDVWLGNNRCGSHPEHTTLSTDDPR
MWSWDIRHLGTLDLAALTSRVLYETGFEKLGLVCHSQGTTQTFVALAKEHRPELGEYISVFCALAPAAYAGPLVS
RPYFRFMSLLSPAMFRIVFGIHSFIPSMMTARRLLPPRIYGTLAYWVFSFLFDWSDTRWERDLRHRMFQFAPVYV
SAEMMRWWLGSDSFAKHKCILSTDNELLQEPNVNPHTRDAVSEHGDDPRDACLGPASSPWYGPRTPPFAFWIGGS
DALVDGRRLLNRFQSGCEPHVSLVHSKIIEEYEHLDVLWAMDAIDQVGREVNKVIWTTMPDDARQICRTPRGLTL
DMVDRG*
Coding >Pro_DTO377G3_2|g7964.t1
ATGCGAGACCTCCAATCCGACCGAATAAAACCGGAGAAGAAAGAGAACGTGGGATTGATGGTCGGCAATAGTATA
GCTGCGTCGGCCATGGATTTCACTGGGACATCATCGTTTAGGGAAAAAAAACGTTCGTCCGGCCTTAATTTCCTG
ACTGCAGAACACCCGCTTTTCCCACCCATGCCCTCGTATGGGCCACCATCCGCATTGCGCAGGGTCCAATACTAT
GCGTTCATCGTTGCTTCATTCTTTCTGTCGATATGCTTCTTGACGGTCATATTCATCGGGGCCCTGATCCACACA
GCCGGAGTCGCAATTTCGGAAGCTCGTCTGCGATTGAGCGGCCATAACCCGGAGACCATGAGGTCGTTCTATACA
GAGGAACAGGCGCGCAGGAAGGCACGGGCAAACGTCGATAGGAGATGGGCTCTGCGCCAACAGAAGAGGGACATG
GACGAGGAACAGGGACCCGAAGAATGCCAAGAATGCCCGTCGTTGGAAGGAGGCAAGGACCCTCTGGTTGGCGAT
GTCGCATACTATGCCCGCCGAGTTGGTCTTGATGTGGAGACATTTCGTGTGCAGACAGAGGATGGTTTCATCATC
ACTCTGTGGCATGTGTACAATCCCCGGGAGTATGAGGCATTATCACCAGAAGAGCGGCGTGAGCGTGGTCCCGAT
GTTTTCACCAAGCCAAGATTGTCGAGCACATCTCGTCCACAATCTAACCGTCGGTATCCTGTTCTCCTGATACAT
GGATTGCTGCAGAACGCTGGCGCATTCTGTACCAATGACGAGGATAGTCTGGCATTTTACCTCTGCAAGTCCGGG
TACGATGTTTGGTTAGGGAATAACCGCTGTGGATCGCACCCAGAGCACACCACTTTGTCGACCGACGACCCGCGT
ATGTGGTCATGGGACATTCGGCATCTCGGGACACTGGATCTCGCAGCACTCACGTCGCGTGTGCTCTACGAGACT
GGGTTCGAGAAGCTAGGTCTAGTGTGCCACTCCCAAGGAACCACGCAGACCTTCGTTGCTCTAGCCAAGGAGCAT
CGTCCTGAGCTGGGTGAATACATCTCGGTTTTCTGCGCGCTTGCACCCGCTGCATATGCAGGCCCGCTTGTAAGC
AGACCGTATTTCCGATTCATGAGTCTTCTCTCTCCGGCGATGTTCCGAATTGTCTTCGGAATTCACTCTTTCATT
CCTTCCATGATGACCGCTCGGCGCCTGCTCCCGCCTAGGATATATGGAACCCTAGCATACTGGGTGTTCTCCTTT
TTGTTTGACTGGTCAGACACGCGCTGGGAGCGTGATCTTCGCCATCGAATGTTCCAATTCGCTCCTGTGTATGTT
AGCGCCGAGATGATGCGCTGGTGGCTGGGAAGCGACAGCTTTGCGAAACATAAATGCATTTTGTCCACAGATAAC
GAACTCCTTCAGGAGCCAAACGTGAACCCGCATACGCGAGATGCTGTTTCTGAGCATGGTGATGATCCCAGAGAC
GCATGTTTGGGCCCGGCCTCAAGCCCCTGGTATGGCCCGAGGACACCCCCGTTTGCTTTCTGGATCGGAGGCTCT
GATGCTCTTGTTGATGGTCGCCGGCTTCTGAATCGCTTTCAAAGTGGCTGCGAGCCTCATGTGAGTCTCGTTCAT
TCAAAGATCATTGAAGAATATGAACATCTCGATGTCCTTTGGGCGATGGATGCGATCGATCAGGTTGGCAGGGAG
GTCAACAAGGTCATTTGGACAACCATGCCTGATGACGCACGTCAGATATGTCGCACTCCGCGTGGTTTAACCCTA
GACATGGTAGACAGAGGTTAG
Transcript >Pro_DTO377G3_2|g7964.t1
ATGCGAGACCTCCAATCCGACCGAATAAAACCGGAGAAGAAAGAGAACGTGGGATTGATGGTCGGCAATAGTATA
GCTGCGTCGGCCATGGATTTCACTGGGACATCATCGTTTAGGGAAAAAAAACGTTCGTCCGGCCTTAATTTCCTG
ACTGCAGAACACCCGCTTTTCCCACCCATGCCCTCGTATGGGCCACCATCCGCATTGCGCAGGGTCCAATACTAT
GCGTTCATCGTTGCTTCATTCTTTCTGTCGATATGCTTCTTGACGGTCATATTCATCGGGGCCCTGATCCACACA
GCCGGAGTCGCAATTTCGGAAGCTCGTCTGCGATTGAGCGGCCATAACCCGGAGACCATGAGGTCGTTCTATACA
GAGGAACAGGCGCGCAGGAAGGCACGGGCAAACGTCGATAGGAGATGGGCTCTGCGCCAACAGAAGAGGGACATG
GACGAGGAACAGGGACCCGAAGAATGCCAAGAATGCCCGTCGTTGGAAGGAGGCAAGGACCCTCTGGTTGGCGAT
GTCGCATACTATGCCCGCCGAGTTGGTCTTGATGTGGAGACATTTCGTGTGCAGACAGAGGATGGTTTCATCATC
ACTCTGTGGCATGTGTACAATCCCCGGGAGTATGAGGCATTATCACCAGAAGAGCGGCGTGAGCGTGGTCCCGAT
GTTTTCACCAAGCCAAGATTGTCGAGCACATCTCGTCCACAATCTAACCGTCGGTATCCTGTTCTCCTGATACAT
GGATTGCTGCAGAACGCTGGCGCATTCTGTACCAATGACGAGGATAGTCTGGCATTTTACCTCTGCAAGTCCGGG
TACGATGTTTGGTTAGGGAATAACCGCTGTGGATCGCACCCAGAGCACACCACTTTGTCGACCGACGACCCGCGT
ATGTGGTCATGGGACATTCGGCATCTCGGGACACTGGATCTCGCAGCACTCACGTCGCGTGTGCTCTACGAGACT
GGGTTCGAGAAGCTAGGTCTAGTGTGCCACTCCCAAGGAACCACGCAGACCTTCGTTGCTCTAGCCAAGGAGCAT
CGTCCTGAGCTGGGTGAATACATCTCGGTTTTCTGCGCGCTTGCACCCGCTGCATATGCAGGCCCGCTTGTAAGC
AGACCGTATTTCCGATTCATGAGTCTTCTCTCTCCGGCGATGTTCCGAATTGTCTTCGGAATTCACTCTTTCATT
CCTTCCATGATGACCGCTCGGCGCCTGCTCCCGCCTAGGATATATGGAACCCTAGCATACTGGGTGTTCTCCTTT
TTGTTTGACTGGTCAGACACGCGCTGGGAGCGTGATCTTCGCCATCGAATGTTCCAATTCGCTCCTGTGTATGTT
AGCGCCGAGATGATGCGCTGGTGGCTGGGAAGCGACAGCTTTGCGAAACATAAATGCATTTTGTCCACAGATAAC
GAACTCCTTCAGGAGCCAAACGTGAACCCGCATACGCGAGATGCTGTTTCTGAGCATGGTGATGATCCCAGAGAC
GCATGTTTGGGCCCGGCCTCAAGCCCCTGGTATGGCCCGAGGACACCCCCGTTTGCTTTCTGGATCGGAGGCTCT
GATGCTCTTGTTGATGGTCGCCGGCTTCTGAATCGCTTTCAAAGTGGCTGCGAGCCTCATGTGAGTCTCGTTCAT
TCAAAGATCATTGAAGAATATGAACATCTCGATGTCCTTTGGGCGATGGATGCGATCGATCAGGTTGGCAGGGAG
GTCAACAAGGTCATTTGGACAACCATGCCTGATGACGCACGTCAGATATGTCGCACTCCGCGTGGTTTAACCCTA
GACATGGTAGACAGAGGTTAG
Gene >Pro_DTO377G3_2|g7964.t1
ATGCGAGACCTCCAATCCGACCGAATAAAACCGGAGAAGAAAGAGAACGTGGGATTGATGGTCGGCAATAGTATA
GCTGCGTCGGCCATGGATTTCACTGGGACATCATCGTTTAGGGAAAAAAAACGTTCGTCCGGCCTTAATTTCCTG
ACTGCAGAACACCCGCTTTTCCCACCCATGCCCTCGTATGGGCCACCATCCGCATTGCGCAGGGTCCAATACTAT
GCGTTCATCGTTGCTTCATTCTTTCTGTCGATATGCTTCTTGACGGTCATATTCATCGGGGCCCTGATCCACACA
GCCGGAGTCGCAATTTCGGAAGCTCGTCTGCGATTGAGCGGCCATAACCCGGAGACCATGAGGTCGTTCTATACA
GAGGAACAGGCGCGCAGGAAGGCACGGGCAAACGTCGATAGGAGATGGGCTCTGCGCCAACAGAAGAGGGACATG
GACGAGGAACAGGGACCCGAAGAATGCCAAGAATGCCCGTCGTTGGAAGGAGGCAAGGACCCTCTGGTTGGCGAT
GTCGCATACTATGCCCGCCGAGTTGGTCTTGATGTGGAGACATTTCGTGTGCAGACAGAGGATGGTTTCATCATC
ACTCTGTGGCATGTGTACAATCCCCGGGAGTATGAGGCATTATCACCAGAAGAGCGGCGTGAGCGTGGTCCCGAT
GTTTTCACCAAGCCAAGATTGTCGAGCACATCTCGTCCACAATCTAACCGTCGGTATCCTGTTCTCCTGATACAT
GGATTGCTGCAGAACGCTGGCGCATTCTGTACCAATGACGAGGATAGTCTGGCATTTTACCTCTGCAAGTCCGGG
TACGATGTTTGGTTAGGGAATAACCGCTGTGGATCGCACCCAGAGCACACCACTTTGTCGACCGACGACCCGCGT
ATGTGGTCATGGGACATTCGGCATCTCGGGACACTGGATCTCGCAGCACTCACGTCGCGTGTGCTCTACGAGACT
GGGTTCGAGAAGCTAGGTCTAGTGTGCCACTCCCAAGGAACCACGCAGACCTTCGTTGCTCTAGCCAAGGAGCAT
CGTCCTGAGCTGGGTGAATACATCTCGGTTTTCTGCGCGCTTGCACCCGCTGCATATGCAGGCCCGCTTGTAAGC
AGACCGTATTTCCGATTCATGAGTCTTCTCTCTCCGGCGATGTTCCGAATTGTCTTCGGAATTCACTCTTTCATT
CCTTCCATGATGACCGCTCGGCGCCTGCTCCCGCCTAGGATATATGGAACCCTAGCATACTGGGTGTTCTCCTTT
TTGTTTGACTGGTCAGACACGCGCTGGGAGCGTGATCTTCGCCATCGAATGTTCCAATTCGCTCCTGTGTATGTT
AGCGCCGAGATGATGCGCTGGTGGCTGGGAAGCGACAGCTTTGCGAAACATAAATGCATTTTGTCCACAGATAAC
GAACTCCTTCAGGAGCCAAACGTGAACCCGCATACGCGAGATGCTGTTTCTGAGCATGGTGATGATCCCAGAGAC
GCATGTTTGGGCCCGGCCTCAAGCCCCTGGTATGGCCCGAGGACACCCCCGTTTGCTTTCTGGATCGGAGGCTCT
GATGCTCTTGTTGATGGTCGCCGGCTTCTGAATCGCTTTCAAAGTGGCTGCGAGCCTCATGTGAGTCTCGTTCAT
TCAAAGATCATTGAAGAATATGAACATCTCGATGTCCTTTGGGCGATGGATGCGATCGATCAGGTTGGCAGGGAG
GTCAACAAGGTCATTTGGACAACCATGCCTGATGACGCACGTCAGATATGTCGCACTCCGCGTGGTTTAACCCTA
GACATGGTAGACAGAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail