Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7943.t1
Gene name
Locationscaffold_27:227918..229425
Strand+
Gene length (bp)1507
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 2.7E-32 89 217

GO

GO Term Description Terminal node
GO:0016409 palmitoyltransferase activity Yes
GO:0016746 acyltransferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 63 19
3 139 158 19
4 178 200 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 17.29 8.16 26.43
5d_25C Five days - 25 degrees Celsius 13.40 5.85 20.94
7d_25C Seven days - 25 degrees Celsius 15.37 6.97 23.77
10d_25C Ten days - 25 degrees Celsius 15.14 6.87 23.41
7d_15C Seven days - 15 degrees Celsius 13.54 5.86 21.22
7d_30C Seven days - 30 degrees Celsius 16.49 7.64 25.34

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.457400 no
3d_25C 7d_25C 0.766963 no
3d_25C 7d_15C 0.482378 no
3d_25C 7d_30C 0.915711 no
3d_25C 10d_25C 0.733756 no
5d_25C 7d_25C 0.733456 no
5d_25C 7d_15C 0.984071 no
5d_25C 7d_30C 0.579392 no
5d_25C 10d_25C 0.764357 no
7d_25C 7d_15C 0.756518 no
7d_25C 7d_30C 0.874256 no
7d_25C 10d_25C 0.976225 no
7d_15C 7d_30C 0.604378 no
7d_15C 10d_25C 0.789525 no
7d_30C 10d_25C 0.840176 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7943.t1
MLGEDFSITKLAIPAVSVLIAFLAYTSQYLFLHFESAPLKRDEIWNINIFALCIWICYYRTCFVDPGRLPKAEER
PKPKEQEGEALASRQRWCRRCEAYKPPRAHHCKTCKRCIPKMDHHCPWTSNCVSHFTIPHFMRFLFYATVGMSYL
ETLLWQRASFVWKNSHLPSYLGPTLGQLIHLFILLVVNSFTTFALFVLLLRSLWAIGSNTTTIETWEIERHATLV
RRARVLGGYLEGPGGIRVHIKKQEYPYDIGIWANIKQSMGGSANVISWFWPLAASPDRRSGWEFETNDFEDPGVS
WPPPDPDRIPVPVSTRSDNISMPAYASIQDEIDAFNRRKQEDMKRFQSPGVQRRKPFHDRYKKGAYAESDSDESG
TDSGGYSEEGEESWRNAEGERLRDFGVDEEAEFYDEEDIPLGVLIERRKRQQSAN*
Coding >Pro_DTO377G3_2|g7943.t1
ATGTTGGGCGAGGACTTTTCAATCACTAAGCTCGCAATTCCCGCCGTCAGTGTTCTAATCGCCTTCCTCGCCTAC
ACATCACAGTACTTGTTTCTGCATTTCGAGTCTGCGCCTCTCAAGAGGGACGAAATTTGGAACATCAATATCTTC
GCTCTGTGCATCTGGATATGCTATTATCGAACCTGCTTTGTAGATCCCGGTCGACTTCCTAAGGCTGAAGAGCGA
CCGAAACCCAAAGAGCAAGAAGGTGAAGCACTCGCTAGTCGCCAGCGATGGTGTCGCAGATGTGAAGCTTACAAA
CCGCCCCGCGCTCACCACTGCAAGACCTGTAAAAGATGCATTCCTAAAATGGATCATCATTGCCCCTGGACCTCG
AACTGCGTCTCACATTTTACCATCCCGCATTTCATGCGCTTTCTATTCTATGCGACTGTTGGCATGTCCTATCTG
GAAACTCTTCTCTGGCAGCGTGCATCATTTGTATGGAAGAACAGTCATCTGCCAAGCTATCTCGGCCCCACGTTG
GGGCAGCTCATCCACTTGTTCATACTGCTGGTAGTAAATAGTTTCACGACTTTCGCCCTCTTTGTTCTCCTGCTT
AGGAGTTTATGGGCAATTGGATCTAACACTACCACCATTGAAACTTGGGAAATCGAGAGGCATGCTACTCTTGTC
CGTCGAGCCCGTGTGCTGGGCGGGTATCTTGAGGGCCCTGGAGGAATTCGAGTTCACATAAAAAAGCAGGAATAT
CCATACGACATTGGGATCTGGGCCAATATCAAGCAAAGTATGGGCGGGAGCGCGAATGTCATAAGCTGGTTCTGG
CCACTGGCCGCATCACCTGATCGCCGGTCCGGCTGGGAATTCGAGACCAATGACTTTGAGGATCCTGGTGTATCA
TGGCCACCTCCAGACCCAGATCGAATCCCGGTGCCGGTTAGTACAAGGTCGGATAACATTAGTATGCCTGCATAC
GCAAGTATTCAGGACGAGATTGATGCCTTCAATCGTCGTAAACAGGAAGACATGAAGCGATTCCAAAGTCCGGGT
GTACAGCGTCGCAAGCCATTTCACGACCGGTACAAAAAAGGTGCCTACGCTGAAAGTGATAGCGATGAGTCCGGA
ACTGACTCCGGGGGTTATTCAGAAGAGGGCGAAGAGTCTTGGCGAAACGCCGAAGGAGAACGACTACGCGACTTT
GGGGTGGACGAGGAAGCAGAATTCTATGATGAGGAAGACATCCCTCTTGGTGTTCTCATTGAGCGACGGAAGCGG
CAGCAATCTGCTAATTGA
Transcript >Pro_DTO377G3_2|g7943.t1
ATGTTGGGCGAGGACTTTTCAATCACTAAGCTCGCAATTCCCGCCGTCAGTGTTCTAATCGCCTTCCTCGCCTAC
ACATCACAGTACTTGTTTCTGCATTTCGAGTCTGCGCCTCTCAAGAGGGACGAAATTTGGAACATCAATATCTTC
GCTCTGTGCATCTGGATATGCTATTATCGAACCTGCTTTGTAGATCCCGGTCGACTTCCTAAGGCTGAAGAGCGA
CCGAAACCCAAAGAGCAAGAAGGTGAAGCACTCGCTAGTCGCCAGCGATGGTGTCGCAGATGTGAAGCTTACAAA
CCGCCCCGCGCTCACCACTGCAAGACCTGTAAAAGATGCATTCCTAAAATGGATCATCATTGCCCCTGGACCTCG
AACTGCGTCTCACATTTTACCATCCCGCATTTCATGCGCTTTCTATTCTATGCGACTGTTGGCATGTCCTATCTG
GAAACTCTTCTCTGGCAGCGTGCATCATTTGTATGGAAGAACAGTCATCTGCCAAGCTATCTCGGCCCCACGTTG
GGGCAGCTCATCCACTTGTTCATACTGCTGGTAGTAAATAGTTTCACGACTTTCGCCCTCTTTGTTCTCCTGCTT
AGGAGTTTATGGGCAATTGGATCTAACACTACCACCATTGAAACTTGGGAAATCGAGAGGCATGCTACTCTTGTC
CGTCGAGCCCGTGTGCTGGGCGGGTATCTTGAGGGCCCTGGAGGAATTCGAGTTCACATAAAAAAGCAGGAATAT
CCATACGACATTGGGATCTGGGCCAATATCAAGCAAAGTATGGGCGGGAGCGCGAATGTCATAAGCTGGTTCTGG
CCACTGGCCGCATCACCTGATCGCCGGTCCGGCTGGGAATTCGAGACCAATGACTTTGAGGATCCTGGTGTATCA
TGGCCACCTCCAGACCCAGATCGAATCCCGGTGCCGGTTAGTACAAGGTCGGATAACATTAGTATGCCTGCATAC
GCAAGTATTCAGGACGAGATTGATGCCTTCAATCGTCGTAAACAGGAAGACATGAAGCGATTCCAAAGTCCGGGT
GTACAGCGTCGCAAGCCATTTCACGACCGGTACAAAAAAGGTGCCTACGCTGAAAGTGATAGCGATGAGTCCGGA
ACTGACTCCGGGGGTTATTCAGAAGAGGGCGAAGAGTCTTGGCGAAACGCCGAAGGAGAACGACTACGCGACTTT
GGGGTGGACGAGGAAGCAGAATTCTATGATGAGGAAGACATCCCTCTTGGTGTTCTCATTGAGCGACGGAAGCGG
CAGCAATCTGCTAATTGA
Gene >Pro_DTO377G3_2|g7943.t1
ATGTTGGGCGAGGACTTTTCAATCACTAAGCTCGCAATTCCCGCCGTCAGTGTTCTAATCGCCTTCCTCGCCTAC
ACATCACAGTACTTGTTTCTGCATTTCGAGTCTGCGCCTCTCAAGAGGGACGAAATTTGGAACATCAATATCTTC
GCTCTGTGCATCTGGATATGCTATTATCGAACCTGCTTTGTAGATCCCGGTCGACTTCCTAAGGCTGAAGAGCGA
CCGAAACCCAAAGAGCAAGAAGGTGAAGCACTCGCTAGTCGCCAGCGATGGTGTCGCAGATGTGAAGCTTACAAA
CCGCCCCGCGCTCACCACTGCAAGACCTGTAAAAGGTTAGATAAGGAATGCTTGATGTGGAGGATTTTGCTGATC
TTCTTCTAGATGCATTCCTAAAATGGATCATCATTGCCCCTGGACCTCGAACTGCGTCTCACATTTTACCATCCC
GCATTTCATGCGCTTTCTATTCTATGCGACTGTTGGCATGTCCTATCTGGAAACTCTTCTCTGGCAGCGTGCATC
ATTTGTATGGAAGAACAGTCATCTGCCAAGCGTAAGTAACTCTGGTACTTCTTTTCATCATTCATGCGGCTAATG
TTGAATAGTATCTCGGCCCCACGTTGGGGCAGCTCATCCACTTGTTCATACTGCTGGTAGTAAATAGTTTCACGA
CTTTCGCCCTCTTTGTTCTCCTGCTTAGGAGTTTATGGGCAATTGGATCTAACACTACCACCATTGAAACTTGGG
AAATCGAGAGGCATGCTACTCTTGTCCGTCGAGCCCGTGTGCTGGGCGGGTATCTTGAGGGCCCTGGAGGAATTC
GAGTTCACATAAAAAAGCAGGAATATCCATACGACATTGGGATCTGGGCCAATATCAAGCAAAGTATGGGCGGGA
GCGCGAATGTGAGTATGCCTGTTCATGGTCCAAATATTGACACGCAAACACGTAAGCTAATGTCTTTTTAGGTCA
TAAGCTGGTTCTGGCCACTGGCCGCATCACCTGATCGCCGGTCCGGCTGGGAATTCGAGACCAATGACTTTGAGG
GTGAGTGGTTGAGTCAGTATTGTGGGTTTTCAATTACTGATCTTTTTTAGATCCTGGTGTATCATGGCCACCTCC
AGACCCAGATCGAATCCCGGTGCCGGTTAGTACAAGGTCGGATAACATTAGTATGCCTGCATACGCAAGTATTCA
GGACGAGATTGATGCCTTCAATCGTCGTAAACAGGAAGACATGAAGCGATTCCAAAGTCCGGGTGTACAGCGTCG
CAAGCCATTTCACGACCGGTACAAAAAAGGTGCCTACGCTGAAAGTGATAGCGATGAGTCCGGAACTGACTCCGG
GGGTTATTCAGAAGAGGGCGAAGAGTCTTGGCGAAACGCCGAAGGAGAACGACTACGCGACTTTGGGGTGGACGA
GGAAGCAGAATTCTATGATGAGGAAGACATCCCTCTTGGTGTTCTCATTGAGCGACGGAAGCGGCAGCAATCTGC
TAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail