Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7942.t1
Gene name
Locationscaffold_27:223950..226470
Strand-
Gene length (bp)2520
Transcript length (bp)2412
Coding sequence length (bp)2412
Protein length (aa) 804

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain 6.5E-12 221 344
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.6E-11 25 120
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 1.1E-09 25 125

GO

GO Term Description Terminal node
GO:0006298 mismatch repair Yes
GO:0005524 ATP binding Yes
GO:0030983 mismatched DNA binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0003676 nucleic acid binding No
GO:0003677 DNA binding No
GO:0030554 adenyl nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:0017076 purine nucleotide binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006281 DNA repair No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006259 DNA metabolic process No
GO:0033554 cellular response to stress No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0051716 cellular response to stimulus No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003690 double-stranded DNA binding No
GO:0050896 response to stimulus No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006950 response to stress No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0036094 small molecule binding No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 11.31 5.72 16.90
5d_25C Five days - 25 degrees Celsius 9.80 4.74 14.86
7d_25C Seven days - 25 degrees Celsius 9.27 4.43 14.11
10d_25C Ten days - 25 degrees Celsius 5.24 2.11 8.37
7d_15C Seven days - 15 degrees Celsius 11.51 5.71 17.30
7d_30C Seven days - 30 degrees Celsius 7.97 3.65 12.28

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.692692 no
3d_25C 7d_25C 0.556939 no
3d_25C 7d_15C 0.969236 no
3d_25C 7d_30C 0.248858 no
3d_25C 10d_25C 0.005626 yes
5d_25C 7d_25C 0.899788 no
5d_25C 7d_15C 0.665121 no
5d_25C 7d_30C 0.560699 no
5d_25C 10d_25C 0.031528 yes
7d_25C 7d_15C 0.528644 no
7d_25C 7d_30C 0.688720 no
7d_25C 10d_25C 0.045566 yes
7d_15C 7d_30C 0.236827 no
7d_15C 10d_25C 0.004450 yes
7d_30C 10d_25C 0.190096 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7942.t1
MTIEALPQKTIRAIGSTSAISDPCSVVKELVDNALDASATSLQVEISQNTVDVIQLKDNGHGISPEDQQNVCKRA
FTSKIQSLDDLKNVGGSSLGFRGEALASVAEMSGLVTVTTRVESEVAGRCLKYGRNGELTGTQRTSHPVGTTVRI
AEFLKHIPVRRQTILKGAAKSLTKIKKLLQAYAIAQPLKRFSFKVLKTKGENSNWVYVPSADASLSDAVLKIAGT
EVFSSCVLKEKSDQTGYEAAAFLPKNIQLDTAKINNAGQFISVDGRPLSNSRGVAHEIVKNFKQHLRVVLKESSD
PFLCLQIRCPRGTYDVNIEPGKDNILFEDQDIVLALVENMFRDHYGTETRNSTQGKENSCKPNESSGGFELLLAR
KPAELAAHPGDPDNPFSLATPCTPLSQNPQALSPPVPSSTVRSKQPSFVNPWSVSRINASFQTPRRGNNYLNQTS
PVDLSSGSLQEPIQREGEPRVVQHSPNSAPISPLTSRLASGSPVKRRRQHPQESTECSPETNRISSARRAQRERD
RDRYGNGALDTWFQRTTQVSLQKSPTEEAPTQEPDSPLSFLTQQRFGLPTNNLPDIMHIDGQNDGCSDSPDLEKA
LDFERRKKEAIQNSRMRVSDNEKTSSSQSAPEFHSPHKSRYLAAKAALTSSQASVSEPVSATTLSPRDPRAYLIR
QARDHSTDETFTKDGKAKRLPTNRLPFERIPDGSDLHDLGLTLSVDLSSGSNLFKCNISENLYTENDNETTAFST
PDLETCVPFWNEQLMLLMKQKYKNMDQSKPLNMHIDLATIISPHVQIAQSNSG*
Coding >Pro_DTO377G3_2|g7942.t1
ATGACAATTGAGGCTCTTCCCCAGAAGACAATCCGGGCGATTGGCTCCACATCTGCCATATCGGATCCCTGCTCT
GTTGTCAAGGAACTTGTAGACAATGCCTTGGATGCTTCTGCCACGTCATTACAGGTTGAAATTTCCCAAAATACC
GTGGATGTCATACAACTCAAGGACAATGGCCACGGAATCTCTCCAGAGGACCAGCAAAATGTCTGCAAACGAGCC
TTTACCAGCAAGATCCAAAGTTTAGATGATCTCAAAAACGTCGGGGGTTCATCATTGGGATTTCGTGGTGAAGCA
CTTGCCAGTGTCGCAGAGATGTCTGGGCTTGTCACTGTCACCACTCGAGTTGAGTCCGAAGTTGCCGGACGATGT
TTGAAGTATGGAAGAAACGGAGAGCTTACTGGAACACAACGGACATCACATCCTGTGGGCACAACTGTTCGTATC
GCAGAATTTCTCAAGCATATACCTGTCCGCAGGCAGACTATCTTGAAGGGTGCTGCAAAAAGTCTTACGAAGATC
AAGAAACTTCTCCAGGCCTACGCTATAGCTCAACCGTTGAAGAGGTTCTCATTCAAAGTCCTCAAGACAAAAGGT
GAAAATAGCAATTGGGTCTACGTGCCGAGCGCAGACGCGTCGCTCTCGGACGCAGTTCTAAAGATAGCTGGCACG
GAAGTTTTTTCTTCCTGTGTCTTGAAAGAAAAATCAGATCAGACAGGATATGAAGCTGCGGCTTTTCTTCCGAAA
AATATACAATTGGATACGGCGAAGATCAACAATGCAGGCCAATTCATCAGTGTAGATGGCCGCCCTCTGTCTAAC
AGCAGGGGTGTTGCCCACGAGATTGTCAAAAATTTCAAGCAGCATCTCCGTGTCGTCTTAAAGGAGTCCAGCGAT
CCTTTTCTCTGTTTACAAATTCGCTGTCCCCGAGGGACGTACGACGTCAATATCGAGCCAGGGAAAGACAACATC
CTGTTTGAAGACCAAGATATAGTCTTGGCCTTGGTAGAGAATATGTTTCGCGACCATTACGGAACGGAGACGAGA
AATTCCACCCAAGGGAAAGAGAATTCCTGCAAACCGAATGAGAGCTCAGGAGGATTCGAACTTTTGCTGGCTAGG
AAGCCAGCAGAGCTTGCCGCACACCCTGGTGATCCTGACAACCCCTTTAGTTTAGCTACACCCTGCACGCCTCTC
TCACAGAATCCGCAAGCCCTTTCGCCCCCGGTTCCTTCCAGCACTGTCAGAAGTAAGCAACCCAGCTTCGTCAAT
CCGTGGTCTGTGTCCAGAATAAATGCTTCGTTTCAAACACCGCGTCGCGGAAACAATTACCTCAATCAAACAAGC
CCCGTGGATCTATCTAGCGGTAGCCTGCAGGAGCCAATCCAAAGAGAGGGTGAACCGCGAGTTGTCCAGCATTCG
CCCAACTCAGCCCCGATAAGTCCTCTTACTTCAAGACTTGCATCTGGGTCGCCAGTGAAGCGCCGCCGCCAGCAT
CCACAAGAATCGACCGAGTGCTCCCCTGAAACTAATCGTATTTCGAGCGCCCGACGCGCTCAGAGGGAACGTGAT
CGAGACCGGTATGGGAACGGCGCTCTAGACACTTGGTTTCAGAGAACAACACAAGTCTCGCTGCAGAAAAGCCCT
ACTGAGGAAGCACCAACTCAAGAACCAGACTCACCGCTTTCTTTTCTTACCCAGCAACGATTCGGATTGCCCACG
AACAATTTGCCAGATATTATGCATATCGATGGGCAGAACGATGGTTGTTCGGACAGTCCAGATCTGGAGAAAGCA
CTAGACTTCGAAAGGAGGAAGAAGGAAGCTATTCAGAACAGTCGGATGCGCGTCAGCGATAACGAGAAAACATCG
AGTTCGCAGTCTGCTCCAGAATTTCATTCGCCTCATAAAAGTCGGTATCTTGCCGCAAAAGCTGCGTTAACTTCG
TCGCAAGCTTCGGTCAGCGAGCCGGTCTCTGCGACAACGCTTTCCCCTCGTGATCCACGAGCATACCTCATTCGT
CAGGCAAGGGATCATTCTACCGACGAAACTTTCACAAAGGACGGAAAGGCAAAGAGACTACCCACCAACCGACTT
CCCTTCGAACGTATACCTGATGGCTCCGACCTTCATGATCTCGGTTTAACGCTCTCGGTCGACTTATCTTCCGGC
TCGAACTTGTTCAAGTGCAATATATCAGAAAATCTATATACTGAGAATGACAACGAAACTACAGCATTCTCGACA
CCTGATCTTGAAACATGCGTGCCGTTCTGGAATGAACAGTTGATGCTTCTCATGAAGCAGAAATACAAAAACATG
GATCAATCAAAGCCTTTGAATATGCACATTGATCTTGCCACCATTATTTCTCCGCATGTGCAAATAGCCCAAAGC
AATTCAGGCTAG
Transcript >Pro_DTO377G3_2|g7942.t1
ATGACAATTGAGGCTCTTCCCCAGAAGACAATCCGGGCGATTGGCTCCACATCTGCCATATCGGATCCCTGCTCT
GTTGTCAAGGAACTTGTAGACAATGCCTTGGATGCTTCTGCCACGTCATTACAGGTTGAAATTTCCCAAAATACC
GTGGATGTCATACAACTCAAGGACAATGGCCACGGAATCTCTCCAGAGGACCAGCAAAATGTCTGCAAACGAGCC
TTTACCAGCAAGATCCAAAGTTTAGATGATCTCAAAAACGTCGGGGGTTCATCATTGGGATTTCGTGGTGAAGCA
CTTGCCAGTGTCGCAGAGATGTCTGGGCTTGTCACTGTCACCACTCGAGTTGAGTCCGAAGTTGCCGGACGATGT
TTGAAGTATGGAAGAAACGGAGAGCTTACTGGAACACAACGGACATCACATCCTGTGGGCACAACTGTTCGTATC
GCAGAATTTCTCAAGCATATACCTGTCCGCAGGCAGACTATCTTGAAGGGTGCTGCAAAAAGTCTTACGAAGATC
AAGAAACTTCTCCAGGCCTACGCTATAGCTCAACCGTTGAAGAGGTTCTCATTCAAAGTCCTCAAGACAAAAGGT
GAAAATAGCAATTGGGTCTACGTGCCGAGCGCAGACGCGTCGCTCTCGGACGCAGTTCTAAAGATAGCTGGCACG
GAAGTTTTTTCTTCCTGTGTCTTGAAAGAAAAATCAGATCAGACAGGATATGAAGCTGCGGCTTTTCTTCCGAAA
AATATACAATTGGATACGGCGAAGATCAACAATGCAGGCCAATTCATCAGTGTAGATGGCCGCCCTCTGTCTAAC
AGCAGGGGTGTTGCCCACGAGATTGTCAAAAATTTCAAGCAGCATCTCCGTGTCGTCTTAAAGGAGTCCAGCGAT
CCTTTTCTCTGTTTACAAATTCGCTGTCCCCGAGGGACGTACGACGTCAATATCGAGCCAGGGAAAGACAACATC
CTGTTTGAAGACCAAGATATAGTCTTGGCCTTGGTAGAGAATATGTTTCGCGACCATTACGGAACGGAGACGAGA
AATTCCACCCAAGGGAAAGAGAATTCCTGCAAACCGAATGAGAGCTCAGGAGGATTCGAACTTTTGCTGGCTAGG
AAGCCAGCAGAGCTTGCCGCACACCCTGGTGATCCTGACAACCCCTTTAGTTTAGCTACACCCTGCACGCCTCTC
TCACAGAATCCGCAAGCCCTTTCGCCCCCGGTTCCTTCCAGCACTGTCAGAAGTAAGCAACCCAGCTTCGTCAAT
CCGTGGTCTGTGTCCAGAATAAATGCTTCGTTTCAAACACCGCGTCGCGGAAACAATTACCTCAATCAAACAAGC
CCCGTGGATCTATCTAGCGGTAGCCTGCAGGAGCCAATCCAAAGAGAGGGTGAACCGCGAGTTGTCCAGCATTCG
CCCAACTCAGCCCCGATAAGTCCTCTTACTTCAAGACTTGCATCTGGGTCGCCAGTGAAGCGCCGCCGCCAGCAT
CCACAAGAATCGACCGAGTGCTCCCCTGAAACTAATCGTATTTCGAGCGCCCGACGCGCTCAGAGGGAACGTGAT
CGAGACCGGTATGGGAACGGCGCTCTAGACACTTGGTTTCAGAGAACAACACAAGTCTCGCTGCAGAAAAGCCCT
ACTGAGGAAGCACCAACTCAAGAACCAGACTCACCGCTTTCTTTTCTTACCCAGCAACGATTCGGATTGCCCACG
AACAATTTGCCAGATATTATGCATATCGATGGGCAGAACGATGGTTGTTCGGACAGTCCAGATCTGGAGAAAGCA
CTAGACTTCGAAAGGAGGAAGAAGGAAGCTATTCAGAACAGTCGGATGCGCGTCAGCGATAACGAGAAAACATCG
AGTTCGCAGTCTGCTCCAGAATTTCATTCGCCTCATAAAAGTCGGTATCTTGCCGCAAAAGCTGCGTTAACTTCG
TCGCAAGCTTCGGTCAGCGAGCCGGTCTCTGCGACAACGCTTTCCCCTCGTGATCCACGAGCATACCTCATTCGT
CAGGCAAGGGATCATTCTACCGACGAAACTTTCACAAAGGACGGAAAGGCAAAGAGACTACCCACCAACCGACTT
CCCTTCGAACGTATACCTGATGGCTCCGACCTTCATGATCTCGGTTTAACGCTCTCGGTCGACTTATCTTCCGGC
TCGAACTTGTTCAAGTGCAATATATCAGAAAATCTATATACTGAGAATGACAACGAAACTACAGCATTCTCGACA
CCTGATCTTGAAACATGCGTGCCGTTCTGGAATGAACAGTTGATGCTTCTCATGAAGCAGAAATACAAAAACATG
GATCAATCAAAGCCTTTGAATATGCACATTGATCTTGCCACCATTATTTCTCCGCATGTGCAAATAGCCCAAAGC
AATTCAGGCTAG
Gene >Pro_DTO377G3_2|g7942.t1
ATGACAATTGAGGCTCTTCCCCAGAAGACAATCCGGGCGATTGGCTCCACATCTGCCATATCGGATCCCTGCTCT
GTTGTCAAGGAACTTGTAGACAATGCCTTGGATGCTTCTGCCACGTCATTACAGGTTGAAATTTCCCAAAATACC
GTGGATGTCATACAACTCAAGGACAATGGCCACGGAATCTCTCCAGAGGACCAGCAAAATGTCTGCAAACGAGCC
TTTACCAGCAAGATCCAAAGTTTAGATGATCTCAAAAACGTCGGGGGTTCATCATTGGGATTTCGTGGTGAAGCA
CTTGCCAGTGTCGCAGAGATGTCTGGGCTTGTCACTGTCACCACTCGAGTTGAGTCCGAAGTTGCCGGACGATGT
TTGAAGTATGGAAGAAACGGAGAGCTTACTGGGTATGTCGACCTCGCCAGATTTTTTGGCCTCTGTGCCACTACT
AAACTTGCATCGCAGAACACAACGGACATCACATCCTGTGGGCACAACTGTTCGTATCGCAGAATTTCTCAAGCA
TATACCTGTCCGCAGGCAGACTATCTTGAAGGGTGCTGCAAAAAGTCTTACGAAGATCAAGAAACTTCTCCAGGC
CTACGCTATAGCTCAACCGTTGAAGAGGTTCTCATTCAAAGTCCTCAAGACAAAAGGTGAAAATAGCAATTGGGT
CTACGTGCCGAGCGCAGACGCGTCGCTCTCGGACGCAGTTCTAAAGATAGCTGGCACGGAAGTTTTTTCTTCCTG
TGTCTTGAAAGAAAAATCAGATCAGACAGGATATGAAGCTGCGGCTTTTCTTCCGAAAAATATACAATTGGGTAA
GCTCATCTTGTTGAATATCCATTGATGTGGTTACCAACCAAATCAGATACGGCGAAGATCAACAATGCAGGCCAA
TTCATCAGTGTAGATGGCCGCCCTCTGTCTAACAGCAGGGGTGTTGCCCACGAGATTGTCAAAAATTTCAAGCAG
CATCTCCGTGTCGTCTTAAAGGAGTCCAGCGATCCTTTTCTCTGTTTACAAATTCGCTGTCCCCGAGGGACGTAC
GACGTCAATATCGAGCCAGGGAAAGACAACATCCTGTTTGAAGACCAAGATATAGTCTTGGCCTTGGTAGAGAAT
ATGTTTCGCGACCATTACGGAACGGAGACGAGAAATTCCACCCAAGGGAAAGAGAATTCCTGCAAACCGAATGAG
AGCTCAGGAGGATTCGAACTTTTGCTGGCTAGGAAGCCAGCAGAGCTTGCCGCACACCCTGGTGATCCTGACAAC
CCCTTTAGTTTAGCTACACCCTGCACGCCTCTCTCACAGAATCCGCAAGCCCTTTCGCCCCCGGTTCCTTCCAGC
ACTGTCAGAAGTAAGCAACCCAGCTTCGTCAATCCGTGGTCTGTGTCCAGAATAAATGCTTCGTTTCAAACACCG
CGTCGCGGAAACAATTACCTCAATCAAACAAGCCCCGTGGATCTATCTAGCGGTAGCCTGCAGGAGCCAATCCAA
AGAGAGGGTGAACCGCGAGTTGTCCAGCATTCGCCCAACTCAGCCCCGATAAGTCCTCTTACTTCAAGACTTGCA
TCTGGGTCGCCAGTGAAGCGCCGCCGCCAGCATCCACAAGAATCGACCGAGTGCTCCCCTGAAACTAATCGTATT
TCGAGCGCCCGACGCGCTCAGAGGGAACGTGATCGAGACCGGTATGGGAACGGCGCTCTAGACACTTGGTTTCAG
AGAACAACACAAGTCTCGCTGCAGAAAAGCCCTACTGAGGAAGCACCAACTCAAGAACCAGACTCACCGCTTTCT
TTTCTTACCCAGCAACGATTCGGATTGCCCACGAACAATTTGCCAGATATTATGCATATCGATGGGCAGAACGAT
GGTTGTTCGGACAGTCCAGATCTGGAGAAAGCACTAGACTTCGAAAGGAGGAAGAAGGAAGCTATTCAGAACAGT
CGGATGCGCGTCAGCGATAACGAGAAAACATCGAGTTCGCAGTCTGCTCCAGAATTTCATTCGCCTCATAAAAGT
CGGTATCTTGCCGCAAAAGCTGCGTTAACTTCGTCGCAAGCTTCGGTCAGCGAGCCGGTCTCTGCGACAACGCTT
TCCCCTCGTGATCCACGAGCATACCTCATTCGTCAGGCAAGGGATCATTCTACCGACGAAACTTTCACAAAGGAC
GGAAAGGCAAAGAGACTACCCACCAACCGACTTCCCTTCGAACGTATACCTGATGGCTCCGACCTTCATGATCTC
GGTTTAACGCTCTCGGTCGACTTATCTTCCGGCTCGAACTTGTTCAAGTGCAATATATCAGAAAATCTATATACT
GAGAATGACAACGAAACTACAGCATTCTCGACACCTGATCTTGAAACATGCGTGCCGTTCTGGAATGAACAGTTG
ATGCTTCTCATGAAGCAGAAATACAAAAACATGGATCAATCAAAGCCTTTGAATATGCACATTGATCTTGCCACC
ATTATTTCTCCGCATGTGCAAATAGCCCAAAGCAATTCAGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail