Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7934.t1
Gene name
Locationscaffold_27:205496..207333
Strand+
Gene length (bp)1837
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 2.7E-108 62 520
PF13520 AA_permease_2 Amino acid permease 4.0E-28 65 497

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 98 120 22
3 133 155 22
4 170 192 22
5 204 226 22
6 246 268 22
7 292 314 22
8 329 351 22
9 388 410 22
10 416 438 22
11 467 489 22
12 494 516 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.28 0.90 5.66
5d_25C Five days - 25 degrees Celsius 2.69 0.62 4.77
7d_25C Seven days - 25 degrees Celsius 2.32 0.35 4.30
10d_25C Ten days - 25 degrees Celsius 1.27 0.05 2.49
7d_15C Seven days - 15 degrees Celsius 4.65 1.27 8.04
7d_30C Seven days - 30 degrees Celsius 2.00 0.32 3.67

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.723731 no
3d_25C 7d_25C 0.511166 no
3d_25C 7d_15C 0.443635 no
3d_25C 7d_30C 0.311374 no
3d_25C 10d_25C 0.059864 no
5d_25C 7d_25C 0.816333 no
5d_25C 7d_15C 0.203824 no
5d_25C 7d_30C 0.597973 no
5d_25C 10d_25C 0.146877 no
7d_25C 7d_15C 0.117102 no
7d_25C 7d_30C 0.826229 no
7d_25C 10d_25C 0.284490 no
7d_15C 7d_30C 0.051079 no
7d_15C 10d_25C 0.008133 yes
7d_30C 10d_25C 0.449820 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7934.t1
MAGVFEEKSSKTGSQYVVHNFHDVEDQPFTPQGPLSAAIPDDGQIVTQNERQSLIRGLGQRHIQMIAIAGAIGTG
LFLGLGGSIATGGPLGALLGYMFIGLIVCCIQFALGEVSALLPVTGSFVRHAEILVDPALAFAIGWNVVYGCFLS
VPSEISASVVLIQYWTDINAAVWVTILIVVSVVVAVSFIGVYGEIEFIFAILKILLVVFVVILGLVIDLGGAPGV
PRRGFHYWKDPGPFVEYIATGSWGQFLGFWAVMTNAVYSFAGVESLAMAAAETQNPRQNIPKACKRVFARVSIFY
LATVLIVGMLVSSADDRISADSGTAATSPFVIAASDAGIRAIPSVVNAVCLSSAWSASNQSILAGTRTLYGLALK
GHAPKIFLRTSKWGVPYMCVLLQMAFSLLAYMCVSNDAMNVFWWFVDLTAAGTLVSWIAIAFNHIRLMQAMDKQG
ISPTELPWHNRITRYTSWFALVACVIILFTGGFTVFTTGNWDTASFISSYLDIPLVLFAYGAYKLIRRTNIIPLR
TIPVQQAIDEANNDPDNLPIKKDSILAKMNIFWG*
Coding >Pro_DTO377G3_2|g7934.t1
ATGGCAGGGGTATTCGAGGAAAAGAGCTCTAAGACAGGGAGTCAGTACGTCGTGCACAATTTTCACGATGTGGAA
GATCAACCCTTCACCCCACAAGGTCCTTTGAGCGCTGCCATCCCCGACGACGGGCAGATCGTTACCCAGAATGAA
CGCCAAAGCTTGATCCGGGGTCTGGGGCAGCGCCATATTCAGATGATTGCCATTGCGGGCGCAATTGGTACGGGT
CTCTTTCTCGGTCTGGGTGGCTCGATCGCCACCGGTGGTCCTCTGGGTGCCCTTTTAGGCTACATGTTCATCGGC
CTGATAGTCTGCTGCATCCAATTTGCGCTGGGAGAAGTCTCAGCGCTGCTACCAGTCACCGGTTCTTTTGTGCGA
CATGCAGAGATTTTGGTCGATCCCGCGCTCGCATTTGCGATCGGCTGGAATGTCGTTTATGGATGCTTTCTCAGC
GTTCCCAGTGAGATCTCCGCCAGCGTGGTTCTTATTCAGTACTGGACGGATATCAACGCCGCCGTCTGGGTGACT
ATCCTCATAGTGGTGTCGGTGGTGGTTGCCGTCTCGTTTATTGGCGTCTACGGCGAGATTGAATTTATCTTCGCC
ATTCTGAAGATCCTGCTGGTTGTCTTCGTGGTCATTCTCGGTCTTGTTATCGATCTCGGCGGTGCGCCGGGTGTG
CCCCGACGCGGCTTCCACTACTGGAAAGACCCCGGCCCATTCGTTGAGTACATTGCCACCGGGTCTTGGGGACAA
TTTCTCGGGTTCTGGGCTGTCATGACTAATGCAGTCTACTCGTTCGCTGGCGTGGAATCATTAGCCATGGCCGCC
GCCGAAACGCAAAACCCACGACAGAATATCCCCAAGGCCTGCAAAAGGGTGTTCGCACGAGTCTCTATCTTCTAC
CTTGCCACCGTCTTGATCGTGGGCATGTTAGTCTCTAGCGCCGACGACCGTATTAGCGCAGACTCCGGCACGGCG
GCCACGAGTCCGTTCGTCATTGCCGCCAGCGACGCAGGTATCAGGGCTATTCCCTCCGTTGTGAACGCAGTATGC
TTGAGCTCTGCGTGGTCTGCATCGAACCAGAGTATTCTGGCCGGAACAAGAACTCTATATGGTCTAGCGCTCAAG
GGCCATGCTCCGAAGATATTCCTGCGCACCTCCAAGTGGGGAGTGCCGTACATGTGTGTGCTGCTGCAGATGGCA
TTCTCTCTACTGGCTTACATGTGTGTTTCCAACGACGCAATGAACGTCTTCTGGTGGTTCGTTGATTTGACTGCG
GCTGGTACCTTGGTCTCGTGGATTGCTATCGCTTTCAACCATATTCGTCTGATGCAAGCAATGGATAAACAGGGC
ATATCGCCAACAGAGTTGCCGTGGCATAACCGAATTACCAGATACACAAGCTGGTTTGCGCTGGTCGCATGTGTC
ATAATTCTCTTCACTGGAGGATTCACAGTCTTCACAACAGGAAACTGGGATACCGCCTCGTTCATCTCGTCGTAT
CTGGACATTCCACTCGTCCTCTTTGCGTACGGGGCTTATAAGTTGATCCGCCGCACAAATATCATTCCTCTAAGG
ACGATACCGGTTCAACAAGCGATAGACGAGGCCAACAACGACCCGGACAACTTGCCGATCAAGAAAGACAGCATA
CTGGCAAAGATGAATATTTTCTGGGGCTGA
Transcript >Pro_DTO377G3_2|g7934.t1
ATGGCAGGGGTATTCGAGGAAAAGAGCTCTAAGACAGGGAGTCAGTACGTCGTGCACAATTTTCACGATGTGGAA
GATCAACCCTTCACCCCACAAGGTCCTTTGAGCGCTGCCATCCCCGACGACGGGCAGATCGTTACCCAGAATGAA
CGCCAAAGCTTGATCCGGGGTCTGGGGCAGCGCCATATTCAGATGATTGCCATTGCGGGCGCAATTGGTACGGGT
CTCTTTCTCGGTCTGGGTGGCTCGATCGCCACCGGTGGTCCTCTGGGTGCCCTTTTAGGCTACATGTTCATCGGC
CTGATAGTCTGCTGCATCCAATTTGCGCTGGGAGAAGTCTCAGCGCTGCTACCAGTCACCGGTTCTTTTGTGCGA
CATGCAGAGATTTTGGTCGATCCCGCGCTCGCATTTGCGATCGGCTGGAATGTCGTTTATGGATGCTTTCTCAGC
GTTCCCAGTGAGATCTCCGCCAGCGTGGTTCTTATTCAGTACTGGACGGATATCAACGCCGCCGTCTGGGTGACT
ATCCTCATAGTGGTGTCGGTGGTGGTTGCCGTCTCGTTTATTGGCGTCTACGGCGAGATTGAATTTATCTTCGCC
ATTCTGAAGATCCTGCTGGTTGTCTTCGTGGTCATTCTCGGTCTTGTTATCGATCTCGGCGGTGCGCCGGGTGTG
CCCCGACGCGGCTTCCACTACTGGAAAGACCCCGGCCCATTCGTTGAGTACATTGCCACCGGGTCTTGGGGACAA
TTTCTCGGGTTCTGGGCTGTCATGACTAATGCAGTCTACTCGTTCGCTGGCGTGGAATCATTAGCCATGGCCGCC
GCCGAAACGCAAAACCCACGACAGAATATCCCCAAGGCCTGCAAAAGGGTGTTCGCACGAGTCTCTATCTTCTAC
CTTGCCACCGTCTTGATCGTGGGCATGTTAGTCTCTAGCGCCGACGACCGTATTAGCGCAGACTCCGGCACGGCG
GCCACGAGTCCGTTCGTCATTGCCGCCAGCGACGCAGGTATCAGGGCTATTCCCTCCGTTGTGAACGCAGTATGC
TTGAGCTCTGCGTGGTCTGCATCGAACCAGAGTATTCTGGCCGGAACAAGAACTCTATATGGTCTAGCGCTCAAG
GGCCATGCTCCGAAGATATTCCTGCGCACCTCCAAGTGGGGAGTGCCGTACATGTGTGTGCTGCTGCAGATGGCA
TTCTCTCTACTGGCTTACATGTGTGTTTCCAACGACGCAATGAACGTCTTCTGGTGGTTCGTTGATTTGACTGCG
GCTGGTACCTTGGTCTCGTGGATTGCTATCGCTTTCAACCATATTCGTCTGATGCAAGCAATGGATAAACAGGGC
ATATCGCCAACAGAGTTGCCGTGGCATAACCGAATTACCAGATACACAAGCTGGTTTGCGCTGGTCGCATGTGTC
ATAATTCTCTTCACTGGAGGATTCACAGTCTTCACAACAGGAAACTGGGATACCGCCTCGTTCATCTCGTCGTAT
CTGGACATTCCACTCGTCCTCTTTGCGTACGGGGCTTATAAGTTGATCCGCCGCACAAATATCATTCCTCTAAGG
ACGATACCGGTTCAACAAGCGATAGACGAGGCCAACAACGACCCGGACAACTTGCCGATCAAGAAAGACAGCATA
CTGGCAAAGATGAATATTTTCTGGGGCTGA
Gene >Pro_DTO377G3_2|g7934.t1
ATGGCAGGGGTATTCGAGGAAAAGAGCTCTAAGACAGGGAGTCAGTACGTCGTGCACAATTTTCACGATGTGGAA
GATCAACCCTTCACCCCACAAGGTCCTTTGAGCGCTGCCATCCCCGACGACGGGCAGATCGTTACCCAGAATGAA
CGCCAAAGCTTGATCCGGGGTCTGGGGCAGCGCCATATTCAGATGATTGCCATTGCGGGCGCAATTGTACGCAAA
CTGTTTATTAGGATTGCAACTTTGTGACTGACCTAAATAGGGTACGGGTCTCTTTCTCGGTCTGGGTGGCTCGAT
CGCCACCGGTGGTCCTCTGGGTGCCCTTTTAGGCTACATGTTCATCGGCCTGATAGTCTGCTGCATCCAATTTGC
GCTGGGAGAAGTCTCAGCGCTGCTACCAGTCACCGGTTCTTTTGTGCGACATGCAGAGATTTTGGTCGATCCCGC
GCTCGCATTTGCGATCGGCTGGAATGTCGTTTATGGATGCTTTCTCAGCGTTCCCAGTGAGATCTCCGCCAGCGT
GGTTCTTATTCAGTACTGGACGGATATCAACGCCGCCGTCTGGGTGACTATCCTCATAGTGGTGTCGGTGGTGGT
TGCCGTCTCGTTTATTGGCGTCTACGGCGAGATTGAATTTATCTTCGCCATTCTGAAGATCCTGCTGGTTGTCTT
CGTGGTCATTCTCGGTCTTGTTATCGATCTCGGCGGTGCGCCGGGTGTGCCCCGACGCGGCTTCCACTACTGGAA
AGACCCCGGCCCATTCGTTGAGTACATTGCCACCGGGTCTTGGGGACAATTTCTCGGGTTCTGGGCTGTCATGAC
TAATGCAGTCTACTCGTTCGCTGGCGTGGAATCATTAGCCATGGCCGCCGCCGAAACGCAAAACCCACGACAGAA
TATCCCCAAGGCCTGCAAAAGGGTGTTCGCACGAGTCTCTATCTTCTACCTTGCCACCGTCTTGATCGTGGGCAT
GTTAGTCTCTAGCGCCGACGACCGTATTAGCGCAGACTCCGGCACGGCGGCCACGAGTCCGTTCGTCATTGCCGC
CAGCGACGCAGGTATCAGGGCTATTCCCTCCGTTGTGAACGCAGTATGCTTGAGCTCTGCGTGGTCTGCATCGAA
CCAGAGTATTCTGGCCGGAACAAGAACTCTATATGGTCTAGCGCTCAAGGGCCATGCTCCGAAGATATTCCTGCG
CACCTCCAAGTGGGGAGTGCCGTACATGTGTGTGCTGCTGCAGATGGCATTCTCTCTACTGGCTTACATGTGTGT
TTCCAACGACGCAATGAACGTCTTCTGGTGGTTCGTTGATTTGACTGCGGCTGGTACCTTGGTCTCGTGGATTGC
TATCGCTTTCAACCATATTCGTCTGATGCAAGCAATGGATAAACAGGGCATATCGCCAACAGAGTTGCCGTGGCA
TAACCGAATTACCAGTATGTATCAGTCTGGTTTCAGATCAGTCTTGAGGTTCTAATACTGACCTTATCAAGGATA
CACAAGCTGGTTTGCGCTGGTCGCATGTGTCATAATTCTCTTCACTGGAGGATTCACAGTCTTCACAACAGGAAA
CTGGGATACCGCCTCGTTCATCTCGTCGTATCTGTGAGTTTTCTTCTCGTACCATTGAGTTCGATCTGCTAACAT
TGACACTAGGGACATTCCACTCGTCCTCTTTGCGTACGGGGCTTATAAGTTGATCCGCCGCACAAATATCATTCC
TCTAAGGACGATACCGGTTCAACAAGCGATAGACGAGGCCAACAACGACCCGGACAACTTGCCGATCAAGAAAGA
CAGCATACTGGCAAAGATGAATATTTTCTGGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail