Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7931.t1
Gene name
Locationscaffold_27:197709..201745
Strand-
Gene length (bp)4036
Transcript length (bp)3792
Coding sequence length (bp)3792
Protein length (aa) 1264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00063 Myosin_head Myosin head (motor domain) 2.4E-244 53 716
PF06017 Myosin_TH1 Unconventional myosin tail, actin- and lipid-binding 5.8E-54 774 969
PF00018 SH3_1 SH3 domain 5.2E-14 1095 1141
PF07653 SH3_2 Variant SH3 domain 6.2E-09 1095 1148
PF14604 SH3_9 Variant SH3 domain 1.4E-08 1096 1146

GO

GO Term Description Terminal node
GO:0003774 cytoskeletal motor activity Yes
GO:0016459 myosin complex Yes
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0005575 cellular_component No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0032991 protein-containing complex No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 31.02 19.02 43.02
5d_25C Five days - 25 degrees Celsius 25.81 15.70 35.92
7d_25C Seven days - 25 degrees Celsius 26.91 16.46 37.37
10d_25C Ten days - 25 degrees Celsius 25.11 15.29 34.92
7d_15C Seven days - 15 degrees Celsius 29.55 17.97 41.13
7d_30C Seven days - 30 degrees Celsius 22.96 13.92 31.99

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.461590 no
3d_25C 7d_25C 0.587953 no
3d_25C 7d_15C 0.874434 no
3d_25C 7d_30C 0.177000 no
3d_25C 10d_25C 0.380358 no
5d_25C 7d_25C 0.897682 no
5d_25C 7d_15C 0.616949 no
5d_25C 7d_30C 0.681121 no
5d_25C 10d_25C 0.934793 no
7d_25C 7d_15C 0.739918 no
7d_25C 7d_30C 0.541030 no
7d_25C 10d_25C 0.817222 no
7d_15C 7d_30C 0.286918 no
7d_15C 10d_25C 0.534401 no
7d_30C 10d_25C 0.758821 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7931.t1
MGQSRRPVGGEKKSRFGRSKAAADVGDGRQAGGKPKVRKAAFESSKKKEIGVSDLTLLSKISNEAINDNLKLRFE
HDEIYTYIGHVLVSVNPFRDLGIYTDSVLDSYRGKNRLEVPPHVFGVAESAYYNMKSYKDNQCVIISGESGAGKT
EAAKRIMQYIASVSGGGDSSIQQTKEMVLATNPLLESFGNAKTLRNNNSSRFGKYLELEFNANGEPVGANITNYL
LEKSRVVGQIVNERNFHIFYQLTKGAPQKYRDSFGLQQPQSYLYTSRSKCYDVPGIDDVAEFKDTLDAMRVIGMS
DAEQDNVFRMLAAILWIGNVQFTEDDSGNAAISDQSIVDFVAYLLEVDAAQVNKALTIRLMETARGGRRGSVYEV
PLNRVQASAVRDALAKGIYFNLFDWIVERVNQSLTARGSITNSIGILDIYGFEIFEKNSFEQLCINYVNEKLQQI
FIQLTLKAEQDEYAREQIKWTPIEYFDNKVVCSLIEDKRPPGVFAALNDACATAHADSGAADQTFVGRLNFLAQN
PNFEARQGQFIIKHYAGDVSYAVEGMTDKNKDQLLKDLLNLAQSSSNEFVHALFPNEVNQDDKRRPPTAGDKIKA
SANDLVATLMKAQPSYIRTIKPNDNKAPKEFNVGNVLHQIKYLGLQENVRIRRAGFAYRQTFDKFTERFYLLSPK
TSYAGDYTWTGDVESGAKQILTDTRIPAEEYQMGITKVFVKTPETLFALEAMRDKYWHNMAIRIQRAWRNYLRYR
IECAIRIQRFWRRMTGGLEFIKIRDQGHKVLQGRKERRRMSLLGSRRFLGDYLGVGNTGGPGEMIRNGAGISGSD
DVVFSCRAEVLVSKFGRSSKPVPRILVLTNRHVFVVAQSIENNQLVISAERTVPVGAIKSVSTSNLKDDWFSLVI
GAQEPDPLIHCVFKTEFFTHLTNVLRGSLTLKIGETIEYHKKPGKLATVKAVKDPGAGNVDSYKSSTIHTSAGEP
PSSVSKPTPRPKAVAARPVTTGKLLRPGGPGGGPSKLSQAARRPVPAAQPLPRSTPQPAMVPQAAAQPQPRIVPQ
SMAAAAAAMHSRNESRSSVRSSGSMRAPPPPPAAPPPASRKPAAKVKYDYNSDRANELSITKGEIVEVVSKEGNG
WWLCKNTTTSEQGWTPESYLEEVAVAPTPKPVPPPPPMAPRATPSPVPNGAGAAAAAKSKPHPPAPPAKRPNMAG
RKPAGAPTARDSAVSMQSNDSSGASGRGTPNSASNVSLAGGLAEALRARQSAMQGKHDDDDEW*
Coding >Pro_DTO377G3_2|g7931.t1
ATGGGTCAGTCACGACGCCCCGTTGGCGGAGAGAAGAAGAGCCGCTTCGGGCGCTCCAAAGCAGCCGCAGATGTT
GGCGATGGCCGGCAAGCGGGGGGAAAGCCGAAGGTCAGGAAGGCCGCCTTCGAGAGCAGCAAGAAGAAGGAGATC
GGCGTGTCAGATCTCACGCTGCTCAGCAAGATCTCCAATGAGGCCATCAACGATAATCTGAAGCTCCGGTTCGAG
CATGACGAGATTTATACTTATATTGGCCATGTGCTGGTCTCAGTAAATCCTTTCCGGGACTTGGGTATCTACACA
GATAGTGTCCTCGATTCGTATCGCGGCAAGAACCGTCTCGAAGTCCCTCCCCATGTATTCGGAGTCGCCGAGTCC
GCATACTACAACATGAAGTCTTACAAGGACAACCAGTGTGTCATCATTTCTGGAGAGTCGGGTGCCGGAAAGACC
GAGGCCGCGAAGCGGATCATGCAATACATTGCCAGTGTCTCCGGCGGCGGCGATTCGTCTATTCAACAGACCAAG
GAAATGGTTTTGGCGACGAACCCGTTGCTGGAGTCATTCGGTAATGCGAAGACGCTGCGCAACAATAACTCGTCC
CGATTCGGAAAATACCTAGAATTGGAGTTCAATGCCAACGGTGAGCCGGTGGGAGCCAACATTACAAATTATCTG
CTGGAAAAGTCGCGAGTTGTGGGACAAATTGTGAATGAGCGCAATTTCCACATCTTTTACCAACTCACAAAGGGG
GCCCCACAAAAGTACCGTGACAGCTTCGGTCTCCAGCAACCACAATCTTACCTCTATACGAGCCGTTCCAAGTGT
TATGATGTGCCCGGAATCGACGATGTTGCCGAGTTCAAGGATACACTGGATGCGATGCGGGTGATTGGAATGAGC
GATGCCGAGCAGGACAATGTGTTCCGCATGCTAGCGGCTATTCTCTGGATTGGAAATGTTCAGTTCACCGAGGAT
GACTCTGGCAACGCTGCTATTAGCGATCAGTCAATCGTTGACTTTGTCGCCTACCTGCTGGAGGTGGATGCTGCT
CAAGTAAACAAAGCGTTGACTATTCGTCTGATGGAGACTGCCCGAGGAGGGCGCAGGGGTTCTGTGTACGAAGTG
CCGCTGAACAGGGTCCAAGCTTCAGCCGTTCGCGACGCTTTGGCCAAGGGAATTTACTTCAATCTGTTCGATTGG
ATTGTAGAGCGCGTCAATCAGTCACTGACTGCTCGAGGCTCCATCACTAATTCGATTGGTATCCTGGATATTTAC
GGATTCGAAATCTTCGAGAAGAACTCTTTCGAGCAGCTGTGTATCAACTATGTCAACGAAAAACTGCAGCAGATT
TTCATTCAATTGACTCTCAAGGCAGAACAAGATGAGTATGCCCGCGAGCAGATCAAGTGGACTCCTATCGAGTAC
TTTGACAACAAGGTGGTGTGCTCGTTGATCGAGGACAAGCGCCCTCCTGGTGTTTTCGCCGCTTTGAATGATGCC
TGCGCAACTGCCCACGCCGATTCCGGTGCGGCCGATCAGACTTTCGTTGGCAGACTCAACTTCCTGGCCCAGAAC
CCCAACTTTGAAGCTCGCCAGGGGCAGTTCATCATCAAGCACTACGCTGGTGATGTCAGTTACGCCGTGGAGGGA
ATGACAGATAAGAACAAGGATCAGCTGTTGAAGGACTTGTTGAACCTTGCCCAATCTAGCAGCAACGAATTCGTC
CACGCGCTGTTCCCCAACGAGGTCAACCAAGATGACAAGCGTCGCCCACCTACCGCCGGTGACAAGATCAAGGCA
TCCGCGAATGACCTTGTGGCCACGCTCATGAAGGCGCAGCCATCTTACATTCGTACCATCAAACCCAACGATAAC
AAGGCCCCCAAGGAATTCAACGTCGGCAATGTCCTGCACCAGATCAAGTACCTGGGTCTCCAGGAAAACGTCCGC
ATTCGACGTGCTGGTTTCGCCTACCGTCAGACCTTCGACAAGTTCACTGAGCGATTCTACCTGTTGTCCCCGAAG
ACTTCCTATGCCGGTGACTACACATGGACTGGTGACGTGGAATCCGGCGCGAAGCAAATCTTGACGGATACCCGC
ATCCCTGCCGAGGAGTATCAGATGGGTATCACAAAGGTTTTCGTCAAGACTCCCGAGACACTATTCGCACTAGAA
GCCATGCGAGACAAATACTGGCACAATATGGCCATCCGCATTCAACGTGCGTGGAGAAACTATCTCCGGTACCGT
ATTGAATGTGCGATCCGTATCCAGCGCTTCTGGCGCCGCATGACCGGCGGACTCGAATTCATCAAGATTCGTGAC
CAGGGACACAAAGTGCTCCAGGGTCGCAAGGAACGTCGGAGAATGAGTCTTCTCGGCTCTCGTCGCTTCCTGGGT
GATTACCTTGGTGTCGGCAATACCGGTGGTCCTGGTGAAATGATCCGCAATGGTGCAGGCATCAGCGGTTCAGAT
GATGTTGTTTTCTCTTGCCGTGCCGAGGTTTTGGTGTCTAAGTTTGGTCGTTCTAGCAAACCTGTTCCGCGGATC
CTGGTCTTGACGAATCGTCACGTTTTCGTTGTTGCACAAAGTATCGAAAACAACCAGCTTGTCATTTCAGCGGAA
CGAACCGTTCCGGTTGGAGCGATCAAGAGTGTCAGCACCTCGAATCTCAAGGATGACTGGTTTTCGCTGGTTATT
GGAGCTCAGGAACCCGACCCGCTAATCCACTGTGTCTTCAAAACCGAGTTCTTCACTCATCTCACCAATGTCCTG
CGTGGCTCTCTGACCTTGAAGATTGGAGAAACCATCGAATACCATAAGAAGCCTGGCAAGCTGGCAACCGTCAAG
GCAGTCAAAGATCCGGGTGCCGGAAACGTGGACAGCTACAAAAGCAGCACAATCCACACTAGTGCTGGTGAGCCT
CCTAGCTCTGTCTCCAAACCTACTCCGCGGCCGAAGGCGGTTGCTGCTCGCCCGGTCACAACGGGCAAGCTACTT
CGTCCTGGTGGCCCCGGTGGCGGCCCTTCGAAATTGTCTCAAGCTGCTCGCAGACCTGTCCCTGCCGCTCAGCCT
CTGCCCCGGTCTACCCCACAGCCTGCCATGGTACCGCAAGCTGCAGCTCAGCCTCAGCCGCGCATCGTGCCCCAG
TCTATGGCAGCTGCTGCCGCCGCCATGCACTCTCGGAACGAGTCGCGTAGCTCAGTGAGATCTTCTGGCTCCATG
AGGGCTCCTCCGCCTCCCCCTGCGGCACCCCCTCCAGCGTCAAGAAAGCCTGCCGCAAAGGTCAAGTACGACTAC
AACAGCGACCGGGCCAATGAGCTTTCCATCACCAAGGGCGAAATTGTGGAGGTTGTGTCCAAGGAAGGAAATGGA
TGGTGGCTGTGCAAGAACACAACAACATCGGAGCAAGGATGGACCCCCGAATCCTACCTCGAAGAAGTAGCCGTC
GCTCCCACACCGAAGCCCGTTCCACCCCCACCTCCGATGGCACCCCGCGCCACCCCCAGCCCTGTTCCAAATGGC
GCTGGAGCTGCAGCAGCTGCAAAGAGCAAGCCTCACCCTCCTGCTCCCCCGGCCAAGCGTCCCAACATGGCCGGG
CGCAAACCCGCAGGCGCGCCCACTGCGCGCGATAGCGCCGTGAGCATGCAGTCAAACGACTCATCGGGCGCCAGC
GGCCGCGGCACGCCCAACAGCGCATCGAACGTCAGCCTGGCAGGTGGTTTGGCCGAGGCACTGCGGGCACGACAA
AGTGCGATGCAGGGCAAACACGACGACGACGATGAGTGGTAG
Transcript >Pro_DTO377G3_2|g7931.t1
ATGGGTCAGTCACGACGCCCCGTTGGCGGAGAGAAGAAGAGCCGCTTCGGGCGCTCCAAAGCAGCCGCAGATGTT
GGCGATGGCCGGCAAGCGGGGGGAAAGCCGAAGGTCAGGAAGGCCGCCTTCGAGAGCAGCAAGAAGAAGGAGATC
GGCGTGTCAGATCTCACGCTGCTCAGCAAGATCTCCAATGAGGCCATCAACGATAATCTGAAGCTCCGGTTCGAG
CATGACGAGATTTATACTTATATTGGCCATGTGCTGGTCTCAGTAAATCCTTTCCGGGACTTGGGTATCTACACA
GATAGTGTCCTCGATTCGTATCGCGGCAAGAACCGTCTCGAAGTCCCTCCCCATGTATTCGGAGTCGCCGAGTCC
GCATACTACAACATGAAGTCTTACAAGGACAACCAGTGTGTCATCATTTCTGGAGAGTCGGGTGCCGGAAAGACC
GAGGCCGCGAAGCGGATCATGCAATACATTGCCAGTGTCTCCGGCGGCGGCGATTCGTCTATTCAACAGACCAAG
GAAATGGTTTTGGCGACGAACCCGTTGCTGGAGTCATTCGGTAATGCGAAGACGCTGCGCAACAATAACTCGTCC
CGATTCGGAAAATACCTAGAATTGGAGTTCAATGCCAACGGTGAGCCGGTGGGAGCCAACATTACAAATTATCTG
CTGGAAAAGTCGCGAGTTGTGGGACAAATTGTGAATGAGCGCAATTTCCACATCTTTTACCAACTCACAAAGGGG
GCCCCACAAAAGTACCGTGACAGCTTCGGTCTCCAGCAACCACAATCTTACCTCTATACGAGCCGTTCCAAGTGT
TATGATGTGCCCGGAATCGACGATGTTGCCGAGTTCAAGGATACACTGGATGCGATGCGGGTGATTGGAATGAGC
GATGCCGAGCAGGACAATGTGTTCCGCATGCTAGCGGCTATTCTCTGGATTGGAAATGTTCAGTTCACCGAGGAT
GACTCTGGCAACGCTGCTATTAGCGATCAGTCAATCGTTGACTTTGTCGCCTACCTGCTGGAGGTGGATGCTGCT
CAAGTAAACAAAGCGTTGACTATTCGTCTGATGGAGACTGCCCGAGGAGGGCGCAGGGGTTCTGTGTACGAAGTG
CCGCTGAACAGGGTCCAAGCTTCAGCCGTTCGCGACGCTTTGGCCAAGGGAATTTACTTCAATCTGTTCGATTGG
ATTGTAGAGCGCGTCAATCAGTCACTGACTGCTCGAGGCTCCATCACTAATTCGATTGGTATCCTGGATATTTAC
GGATTCGAAATCTTCGAGAAGAACTCTTTCGAGCAGCTGTGTATCAACTATGTCAACGAAAAACTGCAGCAGATT
TTCATTCAATTGACTCTCAAGGCAGAACAAGATGAGTATGCCCGCGAGCAGATCAAGTGGACTCCTATCGAGTAC
TTTGACAACAAGGTGGTGTGCTCGTTGATCGAGGACAAGCGCCCTCCTGGTGTTTTCGCCGCTTTGAATGATGCC
TGCGCAACTGCCCACGCCGATTCCGGTGCGGCCGATCAGACTTTCGTTGGCAGACTCAACTTCCTGGCCCAGAAC
CCCAACTTTGAAGCTCGCCAGGGGCAGTTCATCATCAAGCACTACGCTGGTGATGTCAGTTACGCCGTGGAGGGA
ATGACAGATAAGAACAAGGATCAGCTGTTGAAGGACTTGTTGAACCTTGCCCAATCTAGCAGCAACGAATTCGTC
CACGCGCTGTTCCCCAACGAGGTCAACCAAGATGACAAGCGTCGCCCACCTACCGCCGGTGACAAGATCAAGGCA
TCCGCGAATGACCTTGTGGCCACGCTCATGAAGGCGCAGCCATCTTACATTCGTACCATCAAACCCAACGATAAC
AAGGCCCCCAAGGAATTCAACGTCGGCAATGTCCTGCACCAGATCAAGTACCTGGGTCTCCAGGAAAACGTCCGC
ATTCGACGTGCTGGTTTCGCCTACCGTCAGACCTTCGACAAGTTCACTGAGCGATTCTACCTGTTGTCCCCGAAG
ACTTCCTATGCCGGTGACTACACATGGACTGGTGACGTGGAATCCGGCGCGAAGCAAATCTTGACGGATACCCGC
ATCCCTGCCGAGGAGTATCAGATGGGTATCACAAAGGTTTTCGTCAAGACTCCCGAGACACTATTCGCACTAGAA
GCCATGCGAGACAAATACTGGCACAATATGGCCATCCGCATTCAACGTGCGTGGAGAAACTATCTCCGGTACCGT
ATTGAATGTGCGATCCGTATCCAGCGCTTCTGGCGCCGCATGACCGGCGGACTCGAATTCATCAAGATTCGTGAC
CAGGGACACAAAGTGCTCCAGGGTCGCAAGGAACGTCGGAGAATGAGTCTTCTCGGCTCTCGTCGCTTCCTGGGT
GATTACCTTGGTGTCGGCAATACCGGTGGTCCTGGTGAAATGATCCGCAATGGTGCAGGCATCAGCGGTTCAGAT
GATGTTGTTTTCTCTTGCCGTGCCGAGGTTTTGGTGTCTAAGTTTGGTCGTTCTAGCAAACCTGTTCCGCGGATC
CTGGTCTTGACGAATCGTCACGTTTTCGTTGTTGCACAAAGTATCGAAAACAACCAGCTTGTCATTTCAGCGGAA
CGAACCGTTCCGGTTGGAGCGATCAAGAGTGTCAGCACCTCGAATCTCAAGGATGACTGGTTTTCGCTGGTTATT
GGAGCTCAGGAACCCGACCCGCTAATCCACTGTGTCTTCAAAACCGAGTTCTTCACTCATCTCACCAATGTCCTG
CGTGGCTCTCTGACCTTGAAGATTGGAGAAACCATCGAATACCATAAGAAGCCTGGCAAGCTGGCAACCGTCAAG
GCAGTCAAAGATCCGGGTGCCGGAAACGTGGACAGCTACAAAAGCAGCACAATCCACACTAGTGCTGGTGAGCCT
CCTAGCTCTGTCTCCAAACCTACTCCGCGGCCGAAGGCGGTTGCTGCTCGCCCGGTCACAACGGGCAAGCTACTT
CGTCCTGGTGGCCCCGGTGGCGGCCCTTCGAAATTGTCTCAAGCTGCTCGCAGACCTGTCCCTGCCGCTCAGCCT
CTGCCCCGGTCTACCCCACAGCCTGCCATGGTACCGCAAGCTGCAGCTCAGCCTCAGCCGCGCATCGTGCCCCAG
TCTATGGCAGCTGCTGCCGCCGCCATGCACTCTCGGAACGAGTCGCGTAGCTCAGTGAGATCTTCTGGCTCCATG
AGGGCTCCTCCGCCTCCCCCTGCGGCACCCCCTCCAGCGTCAAGAAAGCCTGCCGCAAAGGTCAAGTACGACTAC
AACAGCGACCGGGCCAATGAGCTTTCCATCACCAAGGGCGAAATTGTGGAGGTTGTGTCCAAGGAAGGAAATGGA
TGGTGGCTGTGCAAGAACACAACAACATCGGAGCAAGGATGGACCCCCGAATCCTACCTCGAAGAAGTAGCCGTC
GCTCCCACACCGAAGCCCGTTCCACCCCCACCTCCGATGGCACCCCGCGCCACCCCCAGCCCTGTTCCAAATGGC
GCTGGAGCTGCAGCAGCTGCAAAGAGCAAGCCTCACCCTCCTGCTCCCCCGGCCAAGCGTCCCAACATGGCCGGG
CGCAAACCCGCAGGCGCGCCCACTGCGCGCGATAGCGCCGTGAGCATGCAGTCAAACGACTCATCGGGCGCCAGC
GGCCGCGGCACGCCCAACAGCGCATCGAACGTCAGCCTGGCAGGTGGTTTGGCCGAGGCACTGCGGGCACGACAA
AGTGCGATGCAGGGCAAACACGACGACGACGATGAGTGGTAG
Gene >Pro_DTO377G3_2|g7931.t1
ATGGTAGGTGGCCTACTTGCGCAACGACCAGATAAGGACCAAACTGACCCTGGGATTGCGGTTTAGGGTCAGTCA
CGACGCCCCGTTGGCGGAGAGAAGAAGAGCCGCTTCGGGCGCTCCAAAGCAGCCGCAGATGTTGGCGATGGCCGG
CAAGCGGGGGGAAAGCCGAAGGTCAGGAAGGCCGCCTTCGAGAGCAGCAAGAAGAAGGAGATCGGCGTGTCAGAT
CTCACGCTGCTCAGCAAGATCTCCAATGAGGCCATCAACGATAATCTGAAGCTCCGGTTCGAGCATGACGAGATT
TATGTAAGGGATCGCTCTTGCACGCGGGCTGCGGGGTTGTGCGCGAACACGAATACAGGCTGACAGGAGACTTCC
AGACTTATATTGGCCATGTGCTGGTCTCAGTAAATCCTTTCCGGGACTGTGAGTTGCTCCGCCGAGAGAATTCGG
TTTCCTCCTTGCTAACGGACTTGCGACTACAGTGGGTATCTACACAGATAGTGTCCTCGATTCGTATCGCGGCAA
GAACCGTCTCGAAGTCCCTCCCCATGTATTCGGAGTCGCCGAGTCCGCATACTACAACATGAAGTCTTACAAGGA
CAACCAGTGTGTCATCATTTCTGGAGAGTCGGGTGCCGGAAAGACCGAGGCCGCGAAGCGGATCATGCAATACAT
TGCCAGTGTCTCCGGCGGCGGCGATTCGTCTATTCAACAGACCAAGGAAATGGTTTTGGCGACGAACCCGTTGCT
GGAGTCATTCGGTAATGCGAAGACGCTGCGCAACAATAACTCGTCCCGATTCGGAAAATACCTAGAATTGGAGTT
CAATGCCAACGGTGAGCCGGTGGGAGCCAACATTACAAATTATCTGCTGGAAAAGTCGCGAGTTGTGGGACAAAT
TGTGAATGAGCGCAATTTCCACATCTTTTACCAACTCACAAAGGGGGCCCCACAAAAGTACCGTGACAGCTTCGG
TCTCCAGCAACCACAATCTTACCTCTATACGAGCCGTTCCAAGTGTTATGATGTGCCCGGAATCGACGATGTTGC
CGAGTTCAAGGATACACTGGATGCGATGCGGGTGATTGGAATGAGCGATGCCGAGCAGGACAATGTGTTCCGCAT
GCTAGCGGCTATTCTCTGGATTGGAAATGTTCAGTTCACCGAGGATGACTCTGGCAACGCTGCTATTAGCGATCA
GTCAATCGTTGACTTTGTCGCCTACCTGCTGGAGGTGGATGCTGCTCAAGTAAACAAAGCGTTGACTATTCGTCT
GATGGAGACTGCCCGAGGAGGGCGCAGGGGTTCTGTGTACGAAGTGCCGCTGAACAGGGTCCAAGCTTCAGCCGT
TCGCGACGCTTTGGCCAAGGGAATTTACTTCAATCTGTTCGATTGGATTGTAGAGCGCGTCAATCAGTCACTGAC
TGCTCGAGGCTCCATCACTAATTCGATTGGTATCCTGGATATTTACGGATTCGAAATCTTCGAGAAGAACTCTTT
CGAGCAGCTGTGTATCAACTATGTCAACGAAAAACTGCAGCAGATTTTCATTCAATTGACTCTCAAGGCAGAACA
AGATGAGTATGCCCGCGAGCAGATCAAGTGGACTCCTATCGAGTACTTTGACAACAAGGTGGTGTGCTCGTTGAT
CGAGGACAAGCGCCCTCCTGGTGTTTTCGCCGCTTTGAATGATGCCTGCGCAACTGCCCACGCCGATTCCGGTGC
GGCCGATCAGACTTTCGTTGGCAGACTCAACTTCCTGGCCCAGAACCCCAACTTTGAAGCTCGCCAGGGGCAGTT
CATCATCAAGCACTACGCTGGTGATGTCAGTTACGCCGTGGAGGGAATGACAGATAAGAACAAGGATCAGCTGTT
GAAGGACTTGTTGAACCTTGCCCAATCTAGCAGCAACGAATTCGTCCACGCGCTGTTCCCCAACGAGGTCAACCA
AGATGACAAGCGTCGCCCACCTACCGCCGGTGACAAGATCAAGGCATCCGCGAATGACCTTGTGGCCACGCTCAT
GAAGGCGCAGCCATCTTACATTCGTACCATCAAACCCAACGATAACAAGGCCCCCAAGGAATTCAACGTCGGCAA
TGTCCTGCACCAGATCAAGTACCTGGGTCTCCAGGAAAACGTCCGCATTCGACGTGCTGGTTTCGCCTACCGTCA
GACCTTCGACAAGTTCACTGAGCGATTCTACCTGTTGTCCCCGAAGACTTCCTATGCCGGTGACTACACATGGAC
TGGTGACGTGGAATCCGGCGCGAAGCAAATCTTGACGGATACCCGCATCCCTGCCGAGGAGTATCAGATGGGTAT
CACAAAGGTTTTCGTCAAGACTCCCGAGACACTATTCGCACTAGAAGCCATGCGAGACAAATACTGGCACAATAT
GGCCATCCGCATTCAACGTGCGTGGAGAAACTATCTCCGGTACCGTATTGAATGTGCGATCCGTATCCAGCGCTT
CTGGCGCCGCATGACCGGCGGACTCGAATTCATCAAGATTCGTGACCAGGGACACAAAGTGCTCCAGGGTCGCAA
GGAACGTCGGAGAATGAGTCTTCTCGGCTCTCGTCGCTTCCTGGGTGATTACCTTGGTGTCGGCAATACCGGTGG
TCCTGGTGAAATGATCCGCAATGGTGCAGGCATCAGCGGTTCAGATGATGTTGTTTTCTCTTGCCGTGCCGAGGT
TTTGGTGTCTAAGTTTGGTCGTTCTAGCAAACCTGTTCCGCGGATCCTGGTCTTGACGAATCGTCACGTTTTCGT
TGTTGCACAAAGTATCGAAAACAACCAGCTTGTCATTTCAGCGGAACGAACCGTTCCGGTTGGAGCGATCAAGAG
TGTCAGCACCTCGAATCTCAAGGATGACTGGTTTTCGCTGGTTATTGGAGCTCAGGAACCCGACCCGCTAATCCA
CTGTGTCTTCAAAACCGAGTTCTTCACTCATCTCACCAATGTCCTGCGTGGCTCTCTGACCTTGAAGATTGGAGA
AACCATCGAATACCATAAGAAGCCTGGCAAGCTGGCAACCGTCAAGGCAGTCAAAGATCCGGGTGCCGGAAACGT
GGACAGCTACAAAAGCAGCACAATCCACACTAGTGCTGGTGAGCCTCCTAGCTCTGTCTCCAAACCTACTCCGCG
GCCGAAGGCGGTTGCTGCTCGCCCGGTCACAACGGGCAAGCTACTTCGTCCTGGTGGCCCCGGTGGCGGCCCTTC
GAAATTGTCTCAAGCTGCTCGCAGACCTGTCCCTGCCGCTCAGCCTCTGCCCCGGTCTACCCCACAGCCTGCCAT
GGTACCGCAAGCTGCAGCTCAGCCTCAGCCGCGCATCGTGCCCCAGTCTATGGCAGCTGCTGCCGCCGCCATGCA
CTCTCGGAACGAGTCGCGTAGCTCAGTGAGATCTTCTGGCTCCATGAGGGCTCCTCCGCCTCCCCCTGCGGCACC
CCCTCCAGCGTCAAGAAAGCCTGCCGCAAAGGTCAAGTACGACTACAACAGCGACCGGGCCAATGAGCTTTCCAT
CACCAAGGGCGAAATTGTGGAGGTTGTGTCCAAGGAAGGAAATGGTACGTACCCATAGCATACTTCATTTGAATC
ATACTAACATGTTCTAGGATGGTGGCTGTGCAAGAACACAACAACATCGGAGCAAGGATGGACCCCCGAATCCTA
CCTCGAAGAAGTAGCCGTCGCTCCCACACCGAAGCCCGTTCCACCCCCACCTCCGATGGCACCCCGCGCCACCCC
CAGCCCTGTTCCAAATGGCGCTGGAGCTGCAGCAGCTGCAAAGAGCAAGCCTCACCCTCCTGCTCCCCCGGCCAA
GCGTCCCAACATGGCCGGGCGCAAACCCGCAGGCGCGCCCACTGCGCGCGATAGCGCCGTGAGCATGCAGTCAAA
CGACTCATCGGGCGCCAGCGGCCGCGGCACGCCCAACAGCGCATCGAACGTCAGCCTGGCAGGTGGTTTGGCCGA
GGCACTGCGGGCACGACAAAGTGCGATGCAGGGCAAACACGACGACGACGATGAGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail