Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7919.t1
Gene name
Locationscaffold_27:151967..160008
Strand-
Gene length (bp)8041
Transcript length (bp)7344
Coding sequence length (bp)7344
Protein length (aa) 2448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 4.9E-65 21 267
PF14765 PS-DH Polyketide synthase dehydratase 6.9E-63 900 1179
PF00698 Acyl_transf_1 Acyl transferase domain 7.6E-61 531 850
PF08659 KR KR domain 2.9E-58 2063 2238
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 2.1E-26 391 507
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.8E-26 276 388
PF08242 Methyltransf_12 Methyltransferase domain 2.6E-16 1368 1473
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.5E-14 1904 2039
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.5E-14 1864 1960
PF13489 Methyltransf_23 Methyltransferase domain 8.5E-11 1361 1524
PF13649 Methyltransf_25 Methyltransferase domain 2.1E-10 1367 1471
PF00106 adh_short short chain dehydrogenase 2.5E-09 2066 2229
PF08241 Methyltransf_11 Methyltransferase domain 2.8E-09 1368 1474
PF13847 Methyltransf_31 Methyltransferase domain 2.8E-08 1362 1483
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.7E-05 1348 1480
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.3E-04 1763 1820
PF00550 PP-binding Phosphopantetheine attachment site 3.1E-04 2394 2432

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7919.t1
MNSITGQGQTSCRNHEEDFGDPIAVIGMAMRLPGGVRCGDEFWEMLVNKRDGFCEAPPSRCSREASSSADCGDLS
KTKRGFFLQEDPGCFDTSFFSVPPHEAARLDPQQRLLLEVVWECLENSGETKWRGEKIGCFVGGFGEDWLEISHK
DPQHLTQIFPIATGGYALANQVSYRFDLLGPSMTIQTACSSSLVCLHEACQALRSGECTTALVGGTSLIWSPTMT
DAMTKNMVLSPSGISHTFDAEADGYGRGEGINCIYLKPLRDALRGNDAIRAVIRSTVSNHDGKTPNFSQPCPISQ
ERLIRHAYRIAGIDAIQQTPVFECHGTGTAVGDVIEASVVAKMTRGEATYISAVKPNVGHSEGASGITSIIKSIL
SLEHRTIAPNIHFKTPNPQIPFTEADIHVPLEPTPWPAGRPERISVNSFGIGGSNAHAILESASSVSPKSQPTSL
GLSSPQLLVLSAHTADTLRKRISQTTDYVKNHSDRLHDLSFTLAARRSHLSHRAFAVVQPSNPAIDDAAFSILNT
SSPNVTFVFTGQGAQWPGMGLKLLSEFPTFKEDIKRMDEALQQLPDPPNWLLYDELSQESSISRVHEAEFSQPLC
VALQIGLVNILRGWGIEPSRVVGHSSGEIVAAYAARAISMRSAIVIAYYRGKVAKPLEGLGAMVAVGLSPDEVAL
YLTPGVVVACHNSPHSVTLSGDKDSVDDVTKNIKTANSDTLCRRLTVKIAYHSDQMKQIGSEYEHCISSHIEYEQ
EMLPFCSSVTSNTITDPRKLDASYWRQNLESPVLFTEAIQSLPTSGTPVFLEVGPHSALAAPLRQILRTLATKSP
VYIPTLFRYDEDVQSQLLRTAGQAYANGVGFNLSSLIEPGNTLTDLPPYPWQHDRSYWSESRLSREWRHRKFPHH
EILGSRVVDTTDHEPSWRNLVTLDDVPWLLDHVIQGAVTFPGAGFVAMVGEAVQQLYPDNDSYSVRNATFITPLL
FHEEDQIEIVTSLSPVEVADRVPSGWYSFKIMAHDGERWTMHCQGQVRAGSDHPPEPFPISSYKRALPSESVYRV
LQRSGIDYGPQFQGLEKITADPTGPRATATILGNRGLPGSRYSLHPTAIDQCLQLMGVACSQGLLRHLTTIYVPA
MIDSLFVGPGGPPMPASARTKSGTRDGQLGDAVAMLDDRVVLSIQGAYLFALENDNIDSETGPAGSVTHLEWKSD
IDFLQSSALLSTPHDYTSQAMNIKALGQLSALFVLETAEQIRDFEPRSSHFVKWKKFIMDAASNIKKSGQQSIYP
DSSQWALLSSADRQEMTRKVLAETKFTFDAPLADCMQVVFDNCKAFISGESSPLEVLMKDNLLHQFHAAHTQYAG
WEPFLPSLCHSNPGLRILEIGAGTGSATALALELLKSTSGERMYSQYVFTDISSGFMAAATERFGHEQCIEYKVL
DITLDPLEQGFDPHSFDLIIASNVLHATPSLHTALTHVHCLLKPTGRFLLHEISPEILIANFTMGVFTGWWLGVD
DGRAEQPYISPERWDRELRAAGFTGADVTAYDQKPPYHISASMVSRPVDDISIPTDIWLLTGNSSPSQWASDVEL
LFRDKGYTTHWTTLHEIPPKGKFIVSLLDLEGAAIGCLPKNDYGVFQRYIEQVQECRILWVTQSTSRTCSDPLFG
FIHGFARTLRSELLIDLSILEISTWDAAGAKAVIQVCEKIQRSRAHSLPYPEYEFALHEGEIKVGRYHWTPLVEQ
LASPPRSDASRKLTLTTYGLLDTIHWAEKEPSYELNEGHVEVEMDYVGLNFKDMMVAMGFFGNKEDLGLEGSGIV
LQVGPDVTDIRVGDRVILMHSGVLVSNVVVPQEACIKLPQGLSMADAATMLTAYSVLIHSACGGVGLAALQVCRA
VGAEIYTTVGNDKKVAHLMEHFGLPRERIFNSRNTSFQPDLMRATAGRGVDVVLNSLSGNLLHASWECVAKFGRM
VELGKRDFISHGILNMSLFEANRGFFGVDLAQVCKETPEILKSTLATFSDWYRQGKIGPIHPVKVFDAVDIVSAF
RYMQAGTHLGKILVRMPSSVDSLPPPIVKRFPTFRSDAAYLLIGGLGGVGRSVSTWMVEQGARELIFLSRSAGKS
EEDQAFIGELEAQGCHVSCVLGNVTDLEAVKRAVATCTRPLVGVLQMAVDLKDRLFLQMSHEEWEAALAPKVTGT
WNLHHATLQYSLDFFVVFGSIAGVCGNTGQANYAAATTFLEAFTRYRRQQGLPSSIFHLGVVGDVGAASRSSRFL
QRVQSIALHVLHEAEVIDGLAAAINISPVSDSNASGAIAMGLAHTRRRGDVPKEIFLGGRDARFLIYPNLESTSA
GSGGDQSSHANALKALLAQIQADPSLTGKRETEVALMKELGKFISHNLTGQMQDQGSDSADDIEAMAGMAVDSLM
AIEVRNWLRRSLGVEIPTVEINRAGTLGGLVKVVLKGLGEKYDQCAT*
Coding >Pro_DTO377G3_2|g7919.t1
ATGAATTCAATAACTGGACAAGGACAAACATCATGCAGAAATCACGAGGAGGACTTTGGGGACCCAATTGCTGTC
ATTGGTATGGCAATGCGGCTACCAGGCGGTGTTCGATGTGGAGATGAATTTTGGGAAATGCTCGTGAATAAAAGA
GATGGCTTTTGTGAGGCACCTCCCTCGCGCTGCTCCCGAGAGGCGTCTAGCAGCGCCGATTGTGGAGATCTGAGC
AAAACGAAAAGAGGATTCTTTTTGCAAGAAGATCCAGGTTGTTTTGACACTTCCTTCTTTTCTGTCCCTCCCCAC
GAGGCGGCGCGCCTGGACCCTCAGCAACGGCTCTTGCTGGAGGTGGTTTGGGAGTGCCTGGAGAACTCGGGGGAG
ACTAAGTGGCGCGGCGAGAAAATCGGTTGCTTTGTTGGCGGTTTTGGGGAAGATTGGCTAGAGATATCGCATAAA
GATCCCCAGCATCTGACGCAGATATTTCCTATCGCAACCGGTGGTTATGCATTAGCAAACCAAGTGTCGTATCGA
TTTGATCTCCTAGGTCCGAGCATGACCATCCAGACAGCTTGCTCTTCGTCCCTGGTCTGCCTGCATGAGGCCTGT
CAAGCACTCAGATCTGGAGAGTGCACAACAGCTCTGGTGGGCGGGACGAGCCTTATATGGAGCCCAACCATGACA
GATGCCATGACTAAAAATATGGTTTTGTCACCAAGTGGTATCTCTCATACTTTTGATGCTGAGGCAGATGGCTAT
GGTCGTGGTGAAGGGATCAACTGCATATATCTCAAACCTTTACGCGACGCGCTTCGGGGCAACGACGCGATCCGC
GCCGTCATCCGCTCCACAGTGAGCAACCACGACGGCAAGACCCCTAACTTTTCGCAGCCATGTCCAATATCTCAG
GAGAGGTTGATCCGTCACGCGTATCGGATTGCGGGAATTGACGCGATACAGCAAACACCTGTTTTTGAATGTCAT
GGGACCGGAACAGCCGTCGGCGATGTCATCGAAGCATCAGTCGTTGCAAAGATGACCCGAGGAGAAGCGACATAT
ATCAGTGCTGTCAAACCAAATGTCGGTCACTCGGAGGGTGCCTCAGGCATCACTAGCATCATCAAATCAATCTTG
TCACTTGAACACAGGACCATCGCACCCAATATCCATTTCAAAACGCCGAATCCCCAAATTCCATTCACCGAGGCA
GATATTCATGTCCCTCTAGAGCCGACCCCGTGGCCTGCTGGCAGGCCCGAAAGGATTAGCGTAAATTCGTTCGGT
ATTGGCGGATCCAATGCCCACGCTATTCTGGAGTCCGCCTCTTCGGTCTCTCCAAAGTCCCAACCCACATCGCTC
GGGCTTTCCAGCCCTCAGCTCCTAGTTTTGTCTGCACACACAGCAGACACTCTTCGCAAGCGTATCAGCCAGACC
ACCGACTATGTAAAGAATCACTCAGACCGCCTGCATGATCTTTCGTTCACTTTGGCTGCGCGAAGATCACATCTT
TCCCACCGGGCTTTCGCTGTGGTGCAGCCGAGTAATCCAGCGATAGATGATGCGGCATTTTCAATTCTTAACACC
AGTTCCCCAAATGTCACCTTCGTGTTCACAGGTCAGGGTGCTCAATGGCCCGGAATGGGGCTAAAGCTCTTGTCT
GAATTCCCAACATTCAAGGAAGATATCAAAAGAATGGATGAAGCATTGCAGCAGCTACCTGATCCCCCGAATTGG
TTATTATATGATGAACTAAGCCAAGAGAGTTCAATTTCTCGAGTCCACGAAGCCGAGTTCTCTCAGCCTCTCTGT
GTTGCGCTTCAAATTGGACTAGTAAATATTCTTCGGGGCTGGGGAATCGAGCCATCTAGAGTTGTCGGGCATTCA
AGCGGAGAGATTGTGGCCGCATATGCTGCCAGAGCTATTTCTATGAGAAGTGCTATCGTTATAGCATACTATCGA
GGCAAAGTCGCTAAACCGCTAGAAGGCTTAGGCGCTATGGTGGCCGTTGGCCTTTCCCCGGACGAAGTGGCACTG
TACCTGACACCAGGAGTGGTTGTAGCCTGCCACAATAGTCCGCATAGTGTCACCTTGTCAGGGGATAAAGACTCG
GTTGACGATGTGACCAAAAACATCAAGACAGCAAACTCAGATACACTCTGCCGGCGGCTTACAGTTAAAATCGCC
TATCATTCTGACCAGATGAAACAGATTGGCTCTGAATATGAACATTGTATCTCTAGCCACATCGAATATGAGCAG
GAAATGCTTCCTTTCTGTTCTAGTGTGACTAGCAACACTATCACCGACCCTCGCAAACTAGATGCATCATATTGG
CGACAGAATCTGGAATCACCGGTATTGTTCACCGAGGCTATCCAAAGCCTACCTACTAGTGGAACCCCAGTCTTC
CTAGAAGTCGGGCCGCATTCAGCCCTCGCCGCCCCTCTGCGACAAATCCTCCGGACTCTTGCAACGAAGTCACCA
GTCTATATTCCCACCTTATTTAGGTATGACGAGGATGTCCAAAGCCAGCTACTCCGGACAGCGGGACAGGCCTAT
GCGAACGGCGTAGGATTCAATTTGTCGAGCCTAATTGAGCCCGGGAATACGCTGACAGATCTTCCACCTTATCCT
TGGCAACATGATCGCTCCTATTGGAGTGAGAGTCGACTGAGTAGGGAGTGGAGGCATCGGAAGTTTCCGCATCAT
GAAATCCTCGGCTCGCGGGTCGTCGATACGACTGATCATGAGCCTTCTTGGCGTAATCTGGTCACGCTGGACGAC
GTGCCCTGGCTTTTGGATCATGTAATCCAAGGGGCCGTCACATTCCCTGGCGCTGGGTTCGTCGCTATGGTAGGT
GAGGCAGTCCAGCAGCTGTATCCTGACAACGATAGTTATTCAGTGCGCAATGCGACATTTATAACACCACTACTG
TTCCATGAGGAAGACCAAATCGAGATCGTGACTAGCCTCAGTCCGGTCGAAGTGGCTGACAGGGTTCCATCCGGC
TGGTATAGTTTCAAAATCATGGCCCATGATGGAGAAAGATGGACGATGCATTGTCAGGGTCAAGTAAGAGCCGGG
TCCGATCATCCCCCAGAGCCATTCCCAATATCTTCCTATAAGCGAGCTTTGCCATCAGAAAGTGTGTACCGAGTA
CTTCAAAGGAGCGGTATAGATTACGGCCCTCAGTTCCAGGGCTTGGAAAAGATTACAGCCGATCCTACTGGACCG
AGGGCAACTGCGACCATTCTGGGTAATCGTGGGCTGCCTGGGAGCAGGTATTCGCTTCATCCCACGGCGATTGAT
CAATGTCTCCAACTCATGGGTGTGGCCTGTTCTCAGGGCTTGTTGCGACACCTCACAACAATTTATGTCCCGGCT
ATGATAGATTCCTTGTTCGTCGGACCAGGTGGTCCACCTATGCCAGCAAGTGCCCGGACCAAGAGCGGTACAAGG
GATGGCCAATTGGGCGATGCCGTTGCCATGCTTGACGATCGGGTGGTGCTCTCCATCCAAGGAGCTTATCTTTTT
GCCTTGGAAAATGATAATATAGATTCTGAAACTGGACCCGCGGGCTCAGTAACCCATCTTGAGTGGAAATCGGAT
ATTGATTTCTTGCAATCATCAGCACTTTTGTCTACGCCACACGATTATACATCACAGGCTATGAATATTAAAGCC
TTGGGTCAGCTATCTGCGCTTTTTGTTCTGGAGACCGCGGAGCAAATTCGGGATTTCGAGCCAAGATCATCACAT
TTCGTAAAGTGGAAGAAATTCATCATGGACGCAGCTTCTAATATCAAAAAAAGTGGACAACAATCAATCTACCCA
GATTCATCTCAGTGGGCATTGCTAAGCTCGGCAGACAGACAGGAAATGACACGGAAAGTGTTAGCCGAAACCAAG
TTTACCTTTGATGCTCCACTTGCGGATTGCATGCAGGTTGTCTTCGATAACTGCAAAGCCTTTATATCTGGAGAA
AGTAGCCCATTGGAGGTCCTCATGAAGGACAATCTGCTGCACCAATTCCATGCTGCGCACACACAGTATGCCGGT
TGGGAGCCGTTCCTACCGTCGCTCTGTCATTCCAACCCAGGCCTACGAATACTTGAGATCGGTGCAGGCACCGGG
TCTGCAACTGCCTTGGCTCTAGAGCTTCTCAAGTCCACGAGTGGGGAGCGCATGTATAGCCAGTATGTTTTTACT
GATATCTCTTCTGGTTTTATGGCTGCAGCAACCGAGAGATTCGGTCATGAACAATGCATTGAATACAAAGTTCTT
GATATCACCCTAGATCCCCTCGAACAAGGGTTTGACCCTCATAGCTTTGACTTGATCATCGCTTCCAATGTTCTC
CACGCTACCCCCAGTCTTCATACCGCACTCACTCATGTGCATTGTCTTCTGAAGCCCACCGGTCGCTTCTTACTC
CATGAGATTAGCCCGGAAATCTTAATTGCAAATTTCACCATGGGTGTATTTACCGGCTGGTGGCTAGGGGTGGAT
GATGGTCGAGCAGAGCAACCGTACATCTCACCCGAGCGGTGGGATCGGGAGCTACGAGCAGCAGGTTTCACCGGA
GCAGATGTAACAGCTTATGATCAAAAGCCGCCATATCATATATCTGCCAGCATGGTGTCACGGCCGGTAGACGAT
ATATCCATTCCTACCGATATCTGGTTGCTCACGGGAAATTCTAGCCCGTCCCAGTGGGCGAGTGATGTCGAATTG
CTATTCCGCGACAAAGGCTATACCACTCACTGGACTACCTTGCACGAAATCCCACCCAAAGGCAAATTCATTGTG
TCTCTGCTAGATCTTGAAGGAGCTGCAATAGGTTGCTTGCCGAAGAATGACTATGGGGTATTCCAACGGTACATT
GAGCAAGTGCAAGAATGCCGAATCCTGTGGGTCACGCAGTCAACGTCCCGCACCTGCTCAGATCCACTGTTCGGT
TTCATCCATGGGTTCGCCCGCACTTTACGATCAGAGCTTTTAATTGATCTCTCAATTCTGGAGATTTCCACATGG
GATGCAGCGGGTGCAAAGGCCGTAATTCAAGTGTGCGAGAAGATACAAAGATCCCGCGCGCACTCCCTTCCTTAT
CCAGAGTATGAGTTTGCATTGCATGAAGGCGAGATTAAGGTCGGCCGGTACCACTGGACACCTCTCGTCGAGCAG
CTCGCAAGTCCACCTCGATCAGATGCGTCCCGAAAGCTAACTCTCACGACGTACGGGCTACTGGATACAATACAC
TGGGCCGAGAAAGAGCCATCATATGAGTTGAATGAGGGGCATGTTGAAGTTGAGATGGACTACGTAGGACTGAAC
TTCAAGGATATGATGGTTGCAATGGGCTTTTTCGGAAACAAAGAAGATCTCGGCCTCGAAGGCAGCGGTATTGTG
CTTCAAGTTGGACCTGATGTGACGGATATCAGGGTGGGAGACCGTGTCATCTTGATGCATTCTGGGGTTCTGGTC
TCAAACGTTGTTGTGCCTCAAGAAGCTTGTATCAAGCTACCGCAGGGGTTGTCAATGGCAGATGCGGCCACGATG
TTAACAGCCTATTCCGTTCTCATCCACTCCGCATGTGGCGGGGTCGGGCTAGCCGCTCTGCAAGTATGCCGAGCT
GTTGGTGCCGAGATATATACCACGGTCGGCAACGATAAAAAGGTAGCCCATTTGATGGAGCATTTTGGTTTACCT
CGAGAACGGATATTCAACTCTCGCAACACTTCCTTCCAACCGGACCTAATGCGTGCCACCGCTGGACGGGGAGTT
GATGTAGTACTCAATTCTTTGTCGGGAAACTTACTGCACGCTTCGTGGGAATGTGTCGCAAAGTTCGGACGGATG
GTTGAACTCGGAAAACGTGACTTCATAAGTCACGGAATACTTAATATGAGTCTTTTCGAAGCTAACCGAGGATTT
TTCGGTGTTGACCTCGCACAAGTTTGCAAGGAAACCCCGGAGATTCTCAAAAGCACCCTGGCAACATTTTCAGAT
TGGTATCGTCAAGGGAAAATCGGACCTATCCATCCTGTCAAAGTCTTTGATGCGGTCGACATTGTCAGTGCATTT
AGGTATATGCAGGCAGGCACCCACTTAGGTAAGATCTTGGTGCGTATGCCATCCTCCGTGGACAGTTTGCCTCCT
CCTATCGTCAAAAGATTCCCGACATTCCGATCAGACGCCGCTTATCTTCTGATTGGCGGGCTTGGTGGTGTTGGG
CGATCCGTATCAACATGGATGGTCGAGCAGGGTGCGCGAGAGCTCATCTTCCTCTCGCGATCAGCTGGCAAATCT
GAGGAGGATCAAGCATTTATCGGGGAGCTTGAGGCGCAAGGTTGTCATGTTAGCTGTGTGCTAGGCAATGTGACC
GATCTTGAAGCTGTGAAGCGGGCTGTTGCCACATGCACGCGGCCCCTTGTTGGTGTCCTCCAAATGGCAGTTGAC
TTGAAGGATCGACTGTTCCTGCAGATGAGCCACGAGGAGTGGGAGGCTGCGTTGGCTCCGAAAGTCACTGGAACC
TGGAACCTGCATCATGCCACATTGCAGTACTCACTCGATTTCTTCGTCGTGTTTGGCTCAATTGCCGGGGTATGT
GGTAACACCGGCCAGGCCAATTATGCAGCAGCAACTACATTTTTGGAAGCATTCACCCGGTATCGACGACAGCAG
GGGCTCCCTTCCTCTATTTTCCACCTCGGGGTGGTTGGAGATGTAGGTGCCGCAAGTCGGAGCTCCCGATTCCTT
CAAAGAGTACAGTCAATCGCGCTGCATGTGCTCCATGAAGCTGAAGTGATTGATGGACTCGCCGCGGCGATCAAT
ATATCCCCAGTCAGTGATTCTAATGCGAGTGGTGCAATTGCAATGGGACTTGCGCACACGAGGCGCCGCGGTGAT
GTCCCCAAGGAAATCTTCCTCGGTGGACGCGACGCTCGTTTTTTGATCTACCCCAACCTCGAGTCTACCAGTGCT
GGCAGTGGTGGGGATCAATCCTCTCATGCAAATGCGTTAAAGGCCCTCCTTGCCCAGATACAAGCTGATCCCTCG
CTGACGGGGAAGAGAGAGACTGAGGTCGCCTTGATGAAGGAACTAGGCAAATTTATCAGCCATAATCTTACAGGG
CAGATGCAGGATCAGGGATCAGATTCTGCAGATGACATTGAAGCAATGGCGGGCATGGCAGTTGACTCCCTCATG
GCTATAGAGGTTAGGAATTGGCTACGGAGGTCTCTGGGTGTGGAGATTCCTACAGTGGAAATCAACCGAGCAGGT
ACATTAGGTGGCTTGGTGAAGGTCGTTTTGAAGGGACTTGGGGAGAAATATGATCAGTGTGCTACCTAA
Transcript >Pro_DTO377G3_2|g7919.t1
ATGAATTCAATAACTGGACAAGGACAAACATCATGCAGAAATCACGAGGAGGACTTTGGGGACCCAATTGCTGTC
ATTGGTATGGCAATGCGGCTACCAGGCGGTGTTCGATGTGGAGATGAATTTTGGGAAATGCTCGTGAATAAAAGA
GATGGCTTTTGTGAGGCACCTCCCTCGCGCTGCTCCCGAGAGGCGTCTAGCAGCGCCGATTGTGGAGATCTGAGC
AAAACGAAAAGAGGATTCTTTTTGCAAGAAGATCCAGGTTGTTTTGACACTTCCTTCTTTTCTGTCCCTCCCCAC
GAGGCGGCGCGCCTGGACCCTCAGCAACGGCTCTTGCTGGAGGTGGTTTGGGAGTGCCTGGAGAACTCGGGGGAG
ACTAAGTGGCGCGGCGAGAAAATCGGTTGCTTTGTTGGCGGTTTTGGGGAAGATTGGCTAGAGATATCGCATAAA
GATCCCCAGCATCTGACGCAGATATTTCCTATCGCAACCGGTGGTTATGCATTAGCAAACCAAGTGTCGTATCGA
TTTGATCTCCTAGGTCCGAGCATGACCATCCAGACAGCTTGCTCTTCGTCCCTGGTCTGCCTGCATGAGGCCTGT
CAAGCACTCAGATCTGGAGAGTGCACAACAGCTCTGGTGGGCGGGACGAGCCTTATATGGAGCCCAACCATGACA
GATGCCATGACTAAAAATATGGTTTTGTCACCAAGTGGTATCTCTCATACTTTTGATGCTGAGGCAGATGGCTAT
GGTCGTGGTGAAGGGATCAACTGCATATATCTCAAACCTTTACGCGACGCGCTTCGGGGCAACGACGCGATCCGC
GCCGTCATCCGCTCCACAGTGAGCAACCACGACGGCAAGACCCCTAACTTTTCGCAGCCATGTCCAATATCTCAG
GAGAGGTTGATCCGTCACGCGTATCGGATTGCGGGAATTGACGCGATACAGCAAACACCTGTTTTTGAATGTCAT
GGGACCGGAACAGCCGTCGGCGATGTCATCGAAGCATCAGTCGTTGCAAAGATGACCCGAGGAGAAGCGACATAT
ATCAGTGCTGTCAAACCAAATGTCGGTCACTCGGAGGGTGCCTCAGGCATCACTAGCATCATCAAATCAATCTTG
TCACTTGAACACAGGACCATCGCACCCAATATCCATTTCAAAACGCCGAATCCCCAAATTCCATTCACCGAGGCA
GATATTCATGTCCCTCTAGAGCCGACCCCGTGGCCTGCTGGCAGGCCCGAAAGGATTAGCGTAAATTCGTTCGGT
ATTGGCGGATCCAATGCCCACGCTATTCTGGAGTCCGCCTCTTCGGTCTCTCCAAAGTCCCAACCCACATCGCTC
GGGCTTTCCAGCCCTCAGCTCCTAGTTTTGTCTGCACACACAGCAGACACTCTTCGCAAGCGTATCAGCCAGACC
ACCGACTATGTAAAGAATCACTCAGACCGCCTGCATGATCTTTCGTTCACTTTGGCTGCGCGAAGATCACATCTT
TCCCACCGGGCTTTCGCTGTGGTGCAGCCGAGTAATCCAGCGATAGATGATGCGGCATTTTCAATTCTTAACACC
AGTTCCCCAAATGTCACCTTCGTGTTCACAGGTCAGGGTGCTCAATGGCCCGGAATGGGGCTAAAGCTCTTGTCT
GAATTCCCAACATTCAAGGAAGATATCAAAAGAATGGATGAAGCATTGCAGCAGCTACCTGATCCCCCGAATTGG
TTATTATATGATGAACTAAGCCAAGAGAGTTCAATTTCTCGAGTCCACGAAGCCGAGTTCTCTCAGCCTCTCTGT
GTTGCGCTTCAAATTGGACTAGTAAATATTCTTCGGGGCTGGGGAATCGAGCCATCTAGAGTTGTCGGGCATTCA
AGCGGAGAGATTGTGGCCGCATATGCTGCCAGAGCTATTTCTATGAGAAGTGCTATCGTTATAGCATACTATCGA
GGCAAAGTCGCTAAACCGCTAGAAGGCTTAGGCGCTATGGTGGCCGTTGGCCTTTCCCCGGACGAAGTGGCACTG
TACCTGACACCAGGAGTGGTTGTAGCCTGCCACAATAGTCCGCATAGTGTCACCTTGTCAGGGGATAAAGACTCG
GTTGACGATGTGACCAAAAACATCAAGACAGCAAACTCAGATACACTCTGCCGGCGGCTTACAGTTAAAATCGCC
TATCATTCTGACCAGATGAAACAGATTGGCTCTGAATATGAACATTGTATCTCTAGCCACATCGAATATGAGCAG
GAAATGCTTCCTTTCTGTTCTAGTGTGACTAGCAACACTATCACCGACCCTCGCAAACTAGATGCATCATATTGG
CGACAGAATCTGGAATCACCGGTATTGTTCACCGAGGCTATCCAAAGCCTACCTACTAGTGGAACCCCAGTCTTC
CTAGAAGTCGGGCCGCATTCAGCCCTCGCCGCCCCTCTGCGACAAATCCTCCGGACTCTTGCAACGAAGTCACCA
GTCTATATTCCCACCTTATTTAGGTATGACGAGGATGTCCAAAGCCAGCTACTCCGGACAGCGGGACAGGCCTAT
GCGAACGGCGTAGGATTCAATTTGTCGAGCCTAATTGAGCCCGGGAATACGCTGACAGATCTTCCACCTTATCCT
TGGCAACATGATCGCTCCTATTGGAGTGAGAGTCGACTGAGTAGGGAGTGGAGGCATCGGAAGTTTCCGCATCAT
GAAATCCTCGGCTCGCGGGTCGTCGATACGACTGATCATGAGCCTTCTTGGCGTAATCTGGTCACGCTGGACGAC
GTGCCCTGGCTTTTGGATCATGTAATCCAAGGGGCCGTCACATTCCCTGGCGCTGGGTTCGTCGCTATGGTAGGT
GAGGCAGTCCAGCAGCTGTATCCTGACAACGATAGTTATTCAGTGCGCAATGCGACATTTATAACACCACTACTG
TTCCATGAGGAAGACCAAATCGAGATCGTGACTAGCCTCAGTCCGGTCGAAGTGGCTGACAGGGTTCCATCCGGC
TGGTATAGTTTCAAAATCATGGCCCATGATGGAGAAAGATGGACGATGCATTGTCAGGGTCAAGTAAGAGCCGGG
TCCGATCATCCCCCAGAGCCATTCCCAATATCTTCCTATAAGCGAGCTTTGCCATCAGAAAGTGTGTACCGAGTA
CTTCAAAGGAGCGGTATAGATTACGGCCCTCAGTTCCAGGGCTTGGAAAAGATTACAGCCGATCCTACTGGACCG
AGGGCAACTGCGACCATTCTGGGTAATCGTGGGCTGCCTGGGAGCAGGTATTCGCTTCATCCCACGGCGATTGAT
CAATGTCTCCAACTCATGGGTGTGGCCTGTTCTCAGGGCTTGTTGCGACACCTCACAACAATTTATGTCCCGGCT
ATGATAGATTCCTTGTTCGTCGGACCAGGTGGTCCACCTATGCCAGCAAGTGCCCGGACCAAGAGCGGTACAAGG
GATGGCCAATTGGGCGATGCCGTTGCCATGCTTGACGATCGGGTGGTGCTCTCCATCCAAGGAGCTTATCTTTTT
GCCTTGGAAAATGATAATATAGATTCTGAAACTGGACCCGCGGGCTCAGTAACCCATCTTGAGTGGAAATCGGAT
ATTGATTTCTTGCAATCATCAGCACTTTTGTCTACGCCACACGATTATACATCACAGGCTATGAATATTAAAGCC
TTGGGTCAGCTATCTGCGCTTTTTGTTCTGGAGACCGCGGAGCAAATTCGGGATTTCGAGCCAAGATCATCACAT
TTCGTAAAGTGGAAGAAATTCATCATGGACGCAGCTTCTAATATCAAAAAAAGTGGACAACAATCAATCTACCCA
GATTCATCTCAGTGGGCATTGCTAAGCTCGGCAGACAGACAGGAAATGACACGGAAAGTGTTAGCCGAAACCAAG
TTTACCTTTGATGCTCCACTTGCGGATTGCATGCAGGTTGTCTTCGATAACTGCAAAGCCTTTATATCTGGAGAA
AGTAGCCCATTGGAGGTCCTCATGAAGGACAATCTGCTGCACCAATTCCATGCTGCGCACACACAGTATGCCGGT
TGGGAGCCGTTCCTACCGTCGCTCTGTCATTCCAACCCAGGCCTACGAATACTTGAGATCGGTGCAGGCACCGGG
TCTGCAACTGCCTTGGCTCTAGAGCTTCTCAAGTCCACGAGTGGGGAGCGCATGTATAGCCAGTATGTTTTTACT
GATATCTCTTCTGGTTTTATGGCTGCAGCAACCGAGAGATTCGGTCATGAACAATGCATTGAATACAAAGTTCTT
GATATCACCCTAGATCCCCTCGAACAAGGGTTTGACCCTCATAGCTTTGACTTGATCATCGCTTCCAATGTTCTC
CACGCTACCCCCAGTCTTCATACCGCACTCACTCATGTGCATTGTCTTCTGAAGCCCACCGGTCGCTTCTTACTC
CATGAGATTAGCCCGGAAATCTTAATTGCAAATTTCACCATGGGTGTATTTACCGGCTGGTGGCTAGGGGTGGAT
GATGGTCGAGCAGAGCAACCGTACATCTCACCCGAGCGGTGGGATCGGGAGCTACGAGCAGCAGGTTTCACCGGA
GCAGATGTAACAGCTTATGATCAAAAGCCGCCATATCATATATCTGCCAGCATGGTGTCACGGCCGGTAGACGAT
ATATCCATTCCTACCGATATCTGGTTGCTCACGGGAAATTCTAGCCCGTCCCAGTGGGCGAGTGATGTCGAATTG
CTATTCCGCGACAAAGGCTATACCACTCACTGGACTACCTTGCACGAAATCCCACCCAAAGGCAAATTCATTGTG
TCTCTGCTAGATCTTGAAGGAGCTGCAATAGGTTGCTTGCCGAAGAATGACTATGGGGTATTCCAACGGTACATT
GAGCAAGTGCAAGAATGCCGAATCCTGTGGGTCACGCAGTCAACGTCCCGCACCTGCTCAGATCCACTGTTCGGT
TTCATCCATGGGTTCGCCCGCACTTTACGATCAGAGCTTTTAATTGATCTCTCAATTCTGGAGATTTCCACATGG
GATGCAGCGGGTGCAAAGGCCGTAATTCAAGTGTGCGAGAAGATACAAAGATCCCGCGCGCACTCCCTTCCTTAT
CCAGAGTATGAGTTTGCATTGCATGAAGGCGAGATTAAGGTCGGCCGGTACCACTGGACACCTCTCGTCGAGCAG
CTCGCAAGTCCACCTCGATCAGATGCGTCCCGAAAGCTAACTCTCACGACGTACGGGCTACTGGATACAATACAC
TGGGCCGAGAAAGAGCCATCATATGAGTTGAATGAGGGGCATGTTGAAGTTGAGATGGACTACGTAGGACTGAAC
TTCAAGGATATGATGGTTGCAATGGGCTTTTTCGGAAACAAAGAAGATCTCGGCCTCGAAGGCAGCGGTATTGTG
CTTCAAGTTGGACCTGATGTGACGGATATCAGGGTGGGAGACCGTGTCATCTTGATGCATTCTGGGGTTCTGGTC
TCAAACGTTGTTGTGCCTCAAGAAGCTTGTATCAAGCTACCGCAGGGGTTGTCAATGGCAGATGCGGCCACGATG
TTAACAGCCTATTCCGTTCTCATCCACTCCGCATGTGGCGGGGTCGGGCTAGCCGCTCTGCAAGTATGCCGAGCT
GTTGGTGCCGAGATATATACCACGGTCGGCAACGATAAAAAGGTAGCCCATTTGATGGAGCATTTTGGTTTACCT
CGAGAACGGATATTCAACTCTCGCAACACTTCCTTCCAACCGGACCTAATGCGTGCCACCGCTGGACGGGGAGTT
GATGTAGTACTCAATTCTTTGTCGGGAAACTTACTGCACGCTTCGTGGGAATGTGTCGCAAAGTTCGGACGGATG
GTTGAACTCGGAAAACGTGACTTCATAAGTCACGGAATACTTAATATGAGTCTTTTCGAAGCTAACCGAGGATTT
TTCGGTGTTGACCTCGCACAAGTTTGCAAGGAAACCCCGGAGATTCTCAAAAGCACCCTGGCAACATTTTCAGAT
TGGTATCGTCAAGGGAAAATCGGACCTATCCATCCTGTCAAAGTCTTTGATGCGGTCGACATTGTCAGTGCATTT
AGGTATATGCAGGCAGGCACCCACTTAGGTAAGATCTTGGTGCGTATGCCATCCTCCGTGGACAGTTTGCCTCCT
CCTATCGTCAAAAGATTCCCGACATTCCGATCAGACGCCGCTTATCTTCTGATTGGCGGGCTTGGTGGTGTTGGG
CGATCCGTATCAACATGGATGGTCGAGCAGGGTGCGCGAGAGCTCATCTTCCTCTCGCGATCAGCTGGCAAATCT
GAGGAGGATCAAGCATTTATCGGGGAGCTTGAGGCGCAAGGTTGTCATGTTAGCTGTGTGCTAGGCAATGTGACC
GATCTTGAAGCTGTGAAGCGGGCTGTTGCCACATGCACGCGGCCCCTTGTTGGTGTCCTCCAAATGGCAGTTGAC
TTGAAGGATCGACTGTTCCTGCAGATGAGCCACGAGGAGTGGGAGGCTGCGTTGGCTCCGAAAGTCACTGGAACC
TGGAACCTGCATCATGCCACATTGCAGTACTCACTCGATTTCTTCGTCGTGTTTGGCTCAATTGCCGGGGTATGT
GGTAACACCGGCCAGGCCAATTATGCAGCAGCAACTACATTTTTGGAAGCATTCACCCGGTATCGACGACAGCAG
GGGCTCCCTTCCTCTATTTTCCACCTCGGGGTGGTTGGAGATGTAGGTGCCGCAAGTCGGAGCTCCCGATTCCTT
CAAAGAGTACAGTCAATCGCGCTGCATGTGCTCCATGAAGCTGAAGTGATTGATGGACTCGCCGCGGCGATCAAT
ATATCCCCAGTCAGTGATTCTAATGCGAGTGGTGCAATTGCAATGGGACTTGCGCACACGAGGCGCCGCGGTGAT
GTCCCCAAGGAAATCTTCCTCGGTGGACGCGACGCTCGTTTTTTGATCTACCCCAACCTCGAGTCTACCAGTGCT
GGCAGTGGTGGGGATCAATCCTCTCATGCAAATGCGTTAAAGGCCCTCCTTGCCCAGATACAAGCTGATCCCTCG
CTGACGGGGAAGAGAGAGACTGAGGTCGCCTTGATGAAGGAACTAGGCAAATTTATCAGCCATAATCTTACAGGG
CAGATGCAGGATCAGGGATCAGATTCTGCAGATGACATTGAAGCAATGGCGGGCATGGCAGTTGACTCCCTCATG
GCTATAGAGGTTAGGAATTGGCTACGGAGGTCTCTGGGTGTGGAGATTCCTACAGTGGAAATCAACCGAGCAGGT
ACATTAGGTGGCTTGGTGAAGGTCGTTTTGAAGGGACTTGGGGAGAAATATGATCAGTGTGCTACCTAA
Gene >Pro_DTO377G3_2|g7919.t1
ATGAATTCAATAACTGGACAAGGACAAACATCATGCAGAAATCACGAGGAGGACTTTGGGGACCCAATTGCTGTC
ATTGGTATGGCAATGCGGCTACCAGGCGGTGTTCGATGTGGAGATGAATTTTGGGAAATGCTCGTGAATAAAAGA
GATGGCTTTTGTGAGGCACCTCCCTCGCGCTGCTCCCGAGAGGCGTCTAGCAGCGCCGATTGTGGAGATCTGAGC
AAAACGAAAAGAGGATTCTTTTTGCAAGAAGATCCAGGTTGTTTTGACACTTCCTTCTTTTCTGTCCCTCCCCAC
GAGGCGGCGCGCCTGGACCCTCAGCAACGGCTCTTGCTGGAGGTGGTTTGGGAGTGCCTGGAGAACTCGGGGGAG
ACTAAGTGGCGCGGCGAGAAAATCGGTTGCTTTGTTGGCGGTTTTGGGGAAGATTGGCTAGAGATATCGCATAAA
GATCCCCAGCATCTGACGCAGATATTTCCTATCGCAACCGGTGGTTATGCATTAGCAAACCAAGTGTCGTATCGA
TTTGATCTCCTAGGTCCGAGGTGAGTGCGATCTGCTGTCTTTATTTCAAAAGTCTCTGACCCCTTGCAGCATGAC
CATCCAGACAGCTTGCTCTTCGTCCCTGGTCTGCCTGCATGAGGCCTGTCAAGCACTCAGATCTGGAGAGTGCAC
AACAGCTCTGGTGGGCGGGACGAGCCTTATATGGAGCCCAACCATGACAGATGCCATGACTAAAAATATGGTTTT
GTCACCAAGTGGTATCTCTCATACTTTTGATGCTGAGGCAGATGGCTATGGTCGTGGTGAAGGGATCAACTGCAT
ATATCTCAAACCTTTACGCGACGCGCTTCGGGGCAACGACGCGATCCGCGCCGTCATCCGCTCCACAGTGAGCAA
CCACGACGGCAAGACCCCTAACTTTTCGCAGCCATGTCCAATATCTCAGGAGAGGTTGATCCGTCACGCGTATCG
GATTGCGGGAATTGACGCGATACAGCAAACACCTGTTTTTGAATGTCATGGGACCGGAACAGCCGTCGGCGATGT
CATCGAAGCATCAGTCGTTGCAAAGATGACCCGAGGAGAAGCGACATATATCAGTGCTGTTAGTATTCCCTATTT
GCAGAACTGTCTACAGCCAAACCACTTACTGATGTTGTACACCAGGTCAAACCAAATGTCGGTCACTCGGAGGGT
GCCTCAGGCATCACTAGCATCATCAAATCAATCTTGTCACTTGAACACAGGACCATCGCACCCAATATCCATTTC
AAAACGCCGAATCCCCAAATTCCATTCACCGAGGCAGATATTCATGTCCCTCTAGAGCCGACCCCGTGGCCTGCT
GGCAGGCCCGAAAGGATTAGCGTAAATTCGTTCGGTATTGGCGGATCCAATGCCCACGCTATTCTGGAGTCCGCC
TCTTCGGTCTCTCCAAAGTCCCAACCCACATCGCTCGGGCTTTCCAGCCCTCAGCTCCTAGTTTTGTCTGCACAC
ACAGCAGACACTCTTCGCAAGCGTATCAGCCAGACCACCGACTATGTAAAGAATCACTCAGACCGCCTGCATGAT
CTTTCGTTCACTTTGGCTGCGCGAAGATCACATCTTTCCCACCGGGCTTTCGCTGTGGTGCAGCCGAGTAATCCA
GCGATAGATGATGCGGCATTTTCAATTCTTAACACCAGTTCCCCAAATGTCACCTTCGTGTTCACAGGTCAGGGT
GCTCAATGGCCCGGAATGGGGCTAAAGCTCTTGTCTGAATTCCCAACATTCAAGGAAGATATCAAAAGAATGGAT
GAAGCATTGCAGCAGCTACCTGATCCCCCGAATTGGTTATTATATGGTCAGAAAGAGGGCTTCACCCCTGAAGTT
ACGAGAATATTTTCACTAACGTACCTTCCAGATGAACTAAGCCAAGAGAGTTCAATTTCTCGAGTCCACGAAGCC
GAGTTCTCTCAGCCTCTCTGTGTTGCGCTTCAAATTGGACTAGTAAATATTCTTCGGGGCTGGGGAATCGAGCCA
TCTAGAGTTGTCGGGCATTCAAGCGGAGAGATTGTGGCCGCATATGCTGCCAGAGCTATTTCTATGAGAAGTGCT
ATCGTTATAGCATACTATCGAGGCAAAGTCGCTAAACCGCTAGAAGGCTTAGGCGCTATGGTGGCCGTTGGCCTT
TCCCCGGACGAAGTGGCACTGTACCTGACACCAGGAGTGGTTGTAGCCTGCCACAATAGTCCGCATAGTGTCACC
TTGTCAGGGGATAAAGACTCGGTTGACGATGTGACCAAAAACATCAAGACAGCAAACTCAGATACACTCTGCCGG
CGGCTTACAGTTAAAATCGCCTATCATTCTGGTAAACCCCCCCTGTGCCCTGCGCTTTTACCCTTGCGCTTACAT
TATTTGCAGACCAGATGAAACAGATTGGCTCTGAATATGAACATTGTATCTCTAGCCACATCGAATATGAGCAGG
AAATGCTTCCTTTCTGTTCTAGTGTGACTAGCAACACTATCACCGACCCTCGCAAACTAGATGCATCATATTGGC
GACAGAATCTGGAATCACCGGTATTGTTCACCGAGGCTATCCAAAGCCTACCTACTAGTGGAACCCCAGTCTTCC
TAGAAGTCGGGCCGCATTCAGCCCTCGCCGCCCCTCTGCGACAAATCCTCCGGACTCTTGCAACGAAGTCACCAG
TCTATATTCCCACCTTATTTAGGTATGACGAGGATGTCCAAAGCCAGCTACTCCGGACAGCGGGACAGGCCTATG
CGAACGGCGTAGGATTCAATTTGTCGAGCCTAATTGAGCCCGGGAATACGCTGACAGATCTTCCACCTTATCCTT
GGCAACATGATCGCTCCTATTGGAGTGAGAGTCGACTGAGTAGGGAGTGGAGGCATCGGAAGTTTCCGCATCATG
AAATCCTCGGCTCGCGGGTCGTCGATACGACTGATCATGAGCCTTCTTGGCGTAATCTGGTCACGCTGGACGACG
TGCCCTGGCTTTTGGATCATGTAATCCAAGGGGCCGTCACATTCCCTGGCGCTGGGTTCGTCGCTATGGTAGGTG
AGGCAGTCCAGCAGCTGTATCCTGACAACGATAGTTATTCAGTGCGCAATGCGACATTTATAACACCACTACTGT
TCCATGAGGAAGACCAAATCGAGATCGTGACTAGCCTCAGTCCGGTCGAAGTGGCTGACAGGGTTCCATCCGGCT
GGTATAGTTTCAAAATCATGGCCCATGATGGAGAAAGATGGACGATGCATTGTCAGGGTCAAGTAAGAGCCGGGT
CCGATCATCCCCCAGAGCCATTCCCAATATCTTCCTATAAGCGAGCTTTGCCATCAGAAAGTGTGTACCGAGTAC
TTCAAAGGAGCGGTATAGATTACGGCCCTCAGTTCCAGGGCTTGGAAAAGATTACAGCCGATCCTACTGGACCGA
GGGCAACTGCGACCATTCTGGGTAATCGTGGGCTGCCTGGGAGCAGGTATTCGCTTCATCCCACGGCGATTGATC
AATGTCTCCAACTCATGGGTGTGGCCTGTTCTCAGGGCTTGTTGCGACACCTCACAACAATTTATGTCCCGGCTA
TGATAGATTCCTTGTTCGTCGGACCAGGTGGTCCACCTATGCCAGCAAGTGCCCGGACCAAGAGCGGTACAAGGG
ATGGCCAATTGGGCGATGCCGTTGCCATGCTTGACGATCGGGTGGTGCTCTCCATCCAAGGAGCTTATCTTTTTG
CCTTGGAAAATGATAATATAGATTCTGAAACTGGACCCGCGGGCTCAGTAACCCATCTTGAGTGGAAATCGGATA
TTGATTTCTTGCAATCATCAGCACTTTTGTCTACGCCACACGATTATACATCACAGGCTATGAATATTAAAGCCT
TGGGTCAGCTATCTGCGCTTTTTGTTCTGGAGACCGCGGAGCAAATTCGGGATTTCGAGCCAAGATCATCACATT
TCGTAAAGTGGAAGAAATTCATCATGGACGCAGCTTCTAATATCAAAAAAAGTGGACAACAATCAATCTACCCAG
ATTCATCTCAGTGGGCATTGCTAAGCTCGGCAGACAGACAGGAAATGACACGGAAAGTGTTAGCCGAAACCAAGT
TTACCTTTGATGCTCCACTTGCGGATTGCATGCAGGTTGTCTTCGATAACTGCAAAGCCTTTATATCTGGAGAAA
GTAGCCCATTGGAGGTCCTCATGAAGGACAATCTGCTGCACCAATTCCATGCTGCGCACACACAGTATGCCGGTT
GGGAGCCGTTCCTACCGTCGCTCTGTCATTCCAACCCAGGCCTACGAATACTTGAGATCGGTGCAGGCACCGGGT
CTGCAACTGCCTTGGCTCTAGAGCTTCTCAAGTCCACGAGTGGGGAGCGCATGTATAGCCAGTATGTTTTTACTG
ATATCTCTTCTGGTTTTATGGCTGCAGCAACCGAGAGATTCGGTCATGAACAATGCATTGAATACAAAGTTCTTG
ATATCACCCTAGATCCCCTCGAACAAGGGTTTGACCCTCATAGCTTTGACTTGATCATCGCTTCCAATGTGGGTA
TTTGACTAGTATGCCTCAACCCAATAACGTTGAATTCACATTCTCTACCAGGTTCTCCACGCTACCCCCAGTCTT
CATACCGCACTCACTCATGTGCATTGTCTTCTGAAGCCCACCGGTCGCTTCTTACTCCATGAGATTAGCCCGGGT
ACGTCAAATCCCTCCAGCTTAGATGACTAAACTGACTAGGATACAGAAATCTTAATTGCAAATTTCACCATGGTA
GGTACCAAATTTTCCTTATACCAATATCTGGTTTTCTTACATATTTTAGGGTGTATTTACCGGCTGGTGGCTAGG
GGTGGATGATGGTCGAGCAGAGCAACCGTACATCTCACCCGAGCGGTGGGATCGGGAGCTACGAGCAGCAGGTTT
CACCGGAGCAGATGTAACAGCTTATGATCAAAAGCCGCCATATCATATATCTGCCAGCATGGTGTCACGGCCGGT
AGACGATATATCCATTCCTACCGATATCTGGTTGCTCACGGGAAATTCTAGCCCGTCCCAGTGGGCGAGTGATGT
CGAATTGCTATTCCGCGACAAAGGCTATACCACTCACTGGACTACCTTGCACGAAATCCCACCCAAAGGCAAATT
CATTGTGTCTCTGCTAGATCTTGAAGGAGCTGCAATAGGTTGCTTGCCGAAGAATGACTATGGGGTATTCCAACG
GTACATTGAGCAAGTGCAAGAATGCCGAATCCTGTGGGTCACGCAGTCAACGTCCCGCACCTGCTCAGATCCACT
GTTCGGTTTCATCCATGGGTTCGCCCGCACTTTACGATCAGAGCTTTTAATTGATCTCTCAATTCTGGAGATTTC
CACATGGGATGCAGCGGGTGCAAAGGCCGTAATTCAAGTGTGCGAGAAGATACAAAGATCCCGCGCGCACTCCCT
TCCTTATCCAGAGTATGAGTTTGCATTGCATGAAGGCGAGATTAAGGTCGGCCGGTACCACTGGACACCTCTCGT
CGAGCAGCTCGCAAGTCCACCTCGATCAGATGCGTCCCGAAAGCTAACTCTCACGACGTACGGGCTACTGGATAC
AATACACTGGGCCGAGAAAGAGCCATCATATGAGTTGAATGAGGGGCATGTTGAAGTTGAGATGGACTACGTAGG
ACTGAACTTCAAGGTAAGTTTTCTGCGCCCAAGATAACCTTGCATATCGTTGATCAATATATTCTAGGATATGAT
GGTTGCAATGGGCTTTTTCGGAAACAAAGAAGATCTCGGCCTCGAAGGCAGCGGTATTGTGCTTCAAGTTGGACC
TGATGTGACGGATATCAGGGTGGGAGACCGTGTCATCTTGATGCATTCTGGGGTTCTGGTCTCAAACGTTGTTGT
GCCTCAAGAAGCTTGTATCAAGCTACCGCAGGGGTTGTCAATGGCAGATGCGGCCACGATGTTAACAGCCTATGT
GACTGTTCTCTATTCACTACTTGAGATTGGTGCTTTGAAGAAGGGCCAGGCGAGTCACCATTTAACTCGACTATT
GGTAGTTACTGACATGAAAACAGTCCGTTCTCATCCACTCCGCATGTGGCGGGGTCGGGCTAGCCGCTCTGCAAG
TATGCCGAGCTGTTGGTGCCGAGGTAGGTCAACCTCACGTTATCGTTTTTTTTATGTGGAGCTAATAATAAGTCA
ATATAGATATATACCACGGTCGGCAACGATAAAAAGGTAGCCCATTTGATGGAGCATTTTGGTTTACCTCGAGAA
CGGATATTCAACTCTCGCAACACTTCCTTCCAACCGGACCTAATGCGTGCCACCGCTGGACGGGGAGTTGATGTA
GTACTCAATTCTTTGTCGGGAAACTTACTGCACGCTTCGTGGGAATGTGTCGCAAAGTTCGGACGGATGGTTGAA
CTCGGAAAACGTGACTTCATAAGTCACGGAATACTTAATATGAGTCTTTTCGAAGCTAACCGAGGATTTTTCGGT
GTTGACCTCGCACAAGTTTGCAAGGAAACCCCGGAGATTCTCAAAAGGTTTGTCTCAGATGAGCCTTGAGTGAAC
AAAAGCTGAACTAACACATACAGCACCCTGGCAACATTTTCAGATTGGTATCGTCAAGGGAAAATCGGACCTATC
CATCCTGTCAAAGTCTTTGATGCGGTCGACATTGTCAGTGCATTTAGGTATATGCAGGCAGGCACCCACTTAGGT
AAGATCTTGGTGCGTATGCCATCCTCCGTGGACAGTTTGCCTCCTCCTATCGTCAAAAGATTCCCGACATTCCGA
TCAGACGCCGCTTATCTTCTGATTGGCGGGCTTGGTGGTGTTGGGCGATCCGTATCAACATGGATGGTCGAGCAG
GGTGCGCGAGAGCTCATCTTCCTCTCGCGATCAGCTGGCAAATCTGAGGAGGATCAAGCATTTATCGGGGAGCTT
GAGGCGCAAGGTTGTCATGTTAGCTGTGTGCTAGGCAATGTGACCGATCTTGAAGCTGTGAAGCGGGCTGTTGCC
ACATGCACGCGGCCCCTTGTTGGTGTCCTCCAAATGGCAGTTGACTTGAAGGTAAGTGTTTTTCTCCCTTTCTCC
TAAATGCCATTCCTAATATAGCATCTAGGATCGACTGTTCCTGCAGATGAGCCACGAGGAGTGGGAGGCTGCGTT
GGCTCCGAAAGTCACTGGAACCTGGAACCTGCATCATGCCACATTGCAGTACTCACTCGATTTCTTCGTCGTGTT
TGGCTCAATTGCCGGGGTATGTGGTAACACCGGCCAGGCCAATTATGCAGCAGCAACTACATTTTTGGAAGCATT
CACCCGGTATCGACGACAGCAGGGGCTCCCTTCCTCTATTTTCCACCTCGGGGTGGTTGGAGATGTAGGTGCCGC
AAGTCGGAGCTCCCGATTCCTTCAAAGAGTACAGTCAATCGCGCTGCATGTGCTCCATGAAGCTGAAGTGATTGA
TGGACTCGCCGCGGCGATCAATATATCCCCAGTCAGTGATTCTAATGCGAGTGGTGCAATTGCAATGGGACTTGC
GCACACGAGGCGCCGCGGTGATGTCCCCAAGGAAATCTTCCTCGGTGGACGCGACGCTCGTTTTTTGATCTACCC
CAACCTCGAGTCTACCAGTGCTGGCAGTGGTGGGGATCAATCCTCTCATGCAAATGCGTTAAAGGCCCTCCTTGC
CCAGATACAAGCTGATCCCTCGCTGACGGGGAAGAGAGAGACTGAGGTCGCCTTGATGAAGGAACTAGGCAAATT
TATCAGCCATAATCTTACAGGGCAGATGCAGGATCAGGGATCAGATTCTGCAGATGACATTGAAGCAATGGCGGG
CATGGCAGTTGACTCCCTCATGGCTATAGAGGTTAGGAATTGGCTACGGAGGTCTCTGGGTGTGGAGATTCCTAC
AGTGGAAATCAACCGAGCAGGTACATTAGGTGGCTTGGTGAAGGTCGTTTTGAAGGGACTTGGGGAGAAATATGA
TCAGTGTGCTACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail