Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7918.t1
Gene name
Locationscaffold_27:148756..151576
Strand+
Gene length (bp)2820
Transcript length (bp)2721
Coding sequence length (bp)2721
Protein length (aa) 907

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01734 Patatin Patatin-like phospholipase 8.5E-14 14 195
PF00931 NB-ARC NB-ARC domain 2.4E-09 358 556

GO

GO Term Description Terminal node
GO:0043531 ADP binding Yes
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0008150 biological_process No
GO:0097367 carbohydrate derivative binding No
GO:0071704 organic substance metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.26 0.00 0.58
5d_25C Five days - 25 degrees Celsius 0.25 0.00 0.53
7d_25C Seven days - 25 degrees Celsius 0.33 0.00 0.70
10d_25C Ten days - 25 degrees Celsius 0.02 0.00 0.09
7d_15C Seven days - 15 degrees Celsius 0.30 0.00 0.67
7d_30C Seven days - 30 degrees Celsius 0.84 0.12 1.56

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 1.000000 no
3d_25C 7d_25C 1.000000 no
3d_25C 7d_15C 1.000000 no
3d_25C 7d_30C 0.086818 no
3d_25C 10d_25C 1.000000 no
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 1.000000 no
5d_25C 7d_30C 0.038966 yes
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 1.000000 no
7d_25C 7d_30C 0.101429 no
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 0.109060 no
7d_15C 10d_25C 1.000000 no
7d_30C 10d_25C 0.328074 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7918.t1
MERIRDVHHLDYTPRPCDHFDLIGGTSTGGIIAIMLGRLGMTVDECIRAYRKVAERAFTRKAHAIIPARPRGAFS
ARALQEAIKQVVREFCTEKECVERRRNGLSITDCQHSDLPFREQTCTKTVVLAVTKVNIDAGPTLFRTYDKSTAL
DGCAIWEVARATSAASTLFKSIRLGRDNIEYIDAGFGYNNPCEQLIAEAKKVFPGRSDMQTLSIGTGIGDVVGIK
NGRLSIIGALKRMTTSPNRVNTNMEDYHGDSGQYFRFNVQHGLGDISLSDWKQASRISAYTSIYLSEKSKDIEKY
VKTYGARSQQNELNEPQFTKILIVDPVQKVDVVLGKLKAYHMIPFVANEDFTGREIVLSRLQERLFLQKTARKVA
LYGIGGIGKTQVALHFAYWVKNNMPQYSIFWIPAFSEASFEQACTGIVRDIGIQRIKQDENDMEMVRRYLSSKEA
GPWLFIVDNADDYDILFGSDGVRGRLCKYFPASDTGVILLTTRFSRVAECFTSQRDTIQLLPMEANEAIALFEKL
VANTLIHSRKMTEKLLEELSWLPLAIKQAASYIEFTNVSVSRYLDLMHGTDEDKETPASCHFHDDTRYPQLQNSI
AQIWRISFEKIKRSDPIAADILQFMSCIAPKAIPRSLLPLYKSEAQTESAINTLCEYALVTRGTDGVTLEIHDIV
QLATLWWIDQKGEALETTRKVTQRMVKTFSPRGQTNEHTRRAYVPHALELLRKTEGRDIHERYELILKVVSCLID
DGRVETAMELLKEKAKWDQTRHCEEHPSGLRPQTFLTGAYAADGQTEKAMKLSEYIAPAKERGMQEAHSEQVLPE
WFGAQTSKLRKQQSSSDILARRNYLRQQRNQSAKRALTYESVSLNSKYLVDSSGDYAGERVTQACGYDRAETFRP
RGIHLY*
Coding >Pro_DTO377G3_2|g7918.t1
ATGGAAAGGATCCGCGATGTTCATCATCTTGATTATACCCCACGCCCGTGTGACCATTTCGACTTGATCGGGGGT
ACAAGCACTGGAGGGATCATCGCTATTATGCTGGGTCGGCTGGGAATGACCGTGGATGAATGCATTCGAGCATAC
CGAAAGGTCGCGGAGCGTGCTTTTACTCGCAAGGCACATGCCATTATTCCAGCACGGCCCAGGGGAGCTTTCTCT
GCGCGCGCACTGCAGGAGGCTATCAAACAGGTAGTTCGGGAGTTCTGCACAGAAAAAGAATGCGTGGAACGTCGG
CGCAATGGTCTCTCTATAACTGACTGTCAACACTCTGATCTACCGTTTCGTGAGCAGACATGCACCAAAACGGTT
GTTCTTGCGGTTACGAAAGTGAATATTGACGCGGGACCTACGCTCTTTCGCACATACGACAAATCCACTGCGCTT
GATGGCTGCGCTATTTGGGAAGTTGCCCGCGCTACCTCAGCTGCATCCACGCTCTTCAAGTCAATTAGACTTGGT
CGAGACAACATCGAGTACATTGATGCAGGATTCGGCTATAACAACCCATGCGAACAGCTTATTGCAGAAGCTAAG
AAGGTGTTCCCTGGACGTAGCGATATGCAGACTCTGAGTATCGGAACCGGCATTGGAGATGTGGTCGGCATAAAA
AATGGGCGCCTGTCAATCATTGGTGCACTGAAGAGGATGACTACGTCCCCCAACAGGGTAAACACCAACATGGAA
GACTACCATGGCGACAGCGGCCAGTATTTTCGATTCAATGTGCAACATGGCCTTGGAGATATCTCTTTGTCAGAC
TGGAAGCAGGCTAGCAGGATATCTGCATACACAAGCATTTATCTCTCCGAGAAGTCCAAGGATATCGAGAAATAT
GTGAAGACGTATGGGGCAAGGAGTCAACAAAATGAGCTGAATGAACCTCAGTTTACGAAGATTCTAATAGTCGAC
CCTGTTCAAAAAGTTGACGTGGTTCTAGGCAAGCTAAAGGCCTACCATATGATCCCCTTTGTTGCAAATGAAGAC
TTCACTGGACGTGAGATTGTACTAAGCAGGCTGCAAGAAAGGCTCTTTCTTCAAAAGACCGCCCGTAAAGTGGCC
TTGTACGGAATCGGAGGCATTGGCAAAACCCAGGTTGCCTTGCACTTTGCCTATTGGGTAAAGAACAACATGCCA
CAGTATTCAATATTTTGGATCCCGGCATTCAGCGAAGCCAGCTTTGAGCAAGCGTGTACGGGTATTGTGAGAGAC
ATTGGTATCCAGAGAATAAAGCAAGATGAAAACGATATGGAGATGGTTCGTCGGTATCTTAGCTCCAAGGAAGCT
GGGCCGTGGCTCTTCATTGTGGACAATGCAGACGATTACGACATATTATTTGGAAGCGACGGTGTGCGAGGTCGG
CTTTGCAAATACTTTCCAGCTAGTGACACCGGCGTTATCTTGCTTACCACCCGGTTCAGTCGGGTGGCGGAATGT
TTCACGTCACAGAGAGATACAATCCAACTCTTGCCAATGGAAGCAAATGAAGCGATTGCTTTGTTCGAGAAACTC
GTGGCAAATACTCTCATCCACAGTCGAAAGATGACAGAAAAGCTACTCGAAGAGCTCAGCTGGCTGCCTTTGGCT
ATCAAGCAGGCAGCTTCCTACATTGAATTCACCAATGTATCAGTTTCACGTTATCTCGATCTTATGCATGGTACA
GACGAAGACAAAGAAACCCCCGCGAGTTGTCATTTTCATGATGATACTCGCTACCCGCAGCTGCAGAATTCTATT
GCTCAAATATGGCGTATCTCATTCGAAAAGATCAAAAGGTCAGATCCTATCGCCGCTGATATACTGCAGTTCATG
TCTTGCATTGCGCCGAAAGCCATTCCACGGTCTCTCCTGCCTTTGTACAAATCGGAAGCGCAAACTGAATCCGCA
ATCAATACGCTATGTGAATATGCATTGGTGACCAGAGGGACAGATGGAGTCACGCTTGAAATTCACGATATAGTT
CAGCTCGCAACGCTATGGTGGATTGACCAAAAAGGCGAAGCGTTAGAGACAACCAGGAAGGTCACGCAGCGTATG
GTCAAGACATTCTCACCGCGGGGCCAGACCAATGAACATACGAGGAGGGCGTACGTACCTCATGCTCTTGAACTT
CTTCGTAAGACAGAGGGTCGAGATATACACGAACGGTATGAGCTCATCTTAAAAGTTGTGTCCTGCCTCATAGAT
GATGGTAGGGTGGAAACGGCCATGGAATTACTGAAGGAAAAGGCCAAATGGGACCAAACCCGCCATTGTGAAGAA
CATCCCTCTGGGCTGAGACCTCAAACATTTCTCACTGGGGCATATGCAGCAGATGGGCAGACAGAAAAGGCCATG
AAGCTGAGCGAGTATATCGCCCCGGCGAAAGAGAGAGGAATGCAAGAAGCTCACTCTGAGCAAGTGCTTCCAGAA
TGGTTTGGAGCGCAGACGAGCAAGCTCAGAAAGCAGCAGAGCTCTTCGGATATTTTGGCGAGACGGAATTATCTG
AGACAGCAGAGAAATCAGTCAGCAAAGCGCGCCCTAACCTACGAGAGTGTCAGCCTCAACTCGAAATACCTTGTG
GACAGCTCGGGAGATTACGCGGGCGAGAGAGTCACTCAGGCATGTGGTTATGATCGGGCAGAGACATTCCGCCCA
AGAGGGATTCATCTCTACTAG
Transcript >Pro_DTO377G3_2|g7918.t1
ATGGAAAGGATCCGCGATGTTCATCATCTTGATTATACCCCACGCCCGTGTGACCATTTCGACTTGATCGGGGGT
ACAAGCACTGGAGGGATCATCGCTATTATGCTGGGTCGGCTGGGAATGACCGTGGATGAATGCATTCGAGCATAC
CGAAAGGTCGCGGAGCGTGCTTTTACTCGCAAGGCACATGCCATTATTCCAGCACGGCCCAGGGGAGCTTTCTCT
GCGCGCGCACTGCAGGAGGCTATCAAACAGGTAGTTCGGGAGTTCTGCACAGAAAAAGAATGCGTGGAACGTCGG
CGCAATGGTCTCTCTATAACTGACTGTCAACACTCTGATCTACCGTTTCGTGAGCAGACATGCACCAAAACGGTT
GTTCTTGCGGTTACGAAAGTGAATATTGACGCGGGACCTACGCTCTTTCGCACATACGACAAATCCACTGCGCTT
GATGGCTGCGCTATTTGGGAAGTTGCCCGCGCTACCTCAGCTGCATCCACGCTCTTCAAGTCAATTAGACTTGGT
CGAGACAACATCGAGTACATTGATGCAGGATTCGGCTATAACAACCCATGCGAACAGCTTATTGCAGAAGCTAAG
AAGGTGTTCCCTGGACGTAGCGATATGCAGACTCTGAGTATCGGAACCGGCATTGGAGATGTGGTCGGCATAAAA
AATGGGCGCCTGTCAATCATTGGTGCACTGAAGAGGATGACTACGTCCCCCAACAGGGTAAACACCAACATGGAA
GACTACCATGGCGACAGCGGCCAGTATTTTCGATTCAATGTGCAACATGGCCTTGGAGATATCTCTTTGTCAGAC
TGGAAGCAGGCTAGCAGGATATCTGCATACACAAGCATTTATCTCTCCGAGAAGTCCAAGGATATCGAGAAATAT
GTGAAGACGTATGGGGCAAGGAGTCAACAAAATGAGCTGAATGAACCTCAGTTTACGAAGATTCTAATAGTCGAC
CCTGTTCAAAAAGTTGACGTGGTTCTAGGCAAGCTAAAGGCCTACCATATGATCCCCTTTGTTGCAAATGAAGAC
TTCACTGGACGTGAGATTGTACTAAGCAGGCTGCAAGAAAGGCTCTTTCTTCAAAAGACCGCCCGTAAAGTGGCC
TTGTACGGAATCGGAGGCATTGGCAAAACCCAGGTTGCCTTGCACTTTGCCTATTGGGTAAAGAACAACATGCCA
CAGTATTCAATATTTTGGATCCCGGCATTCAGCGAAGCCAGCTTTGAGCAAGCGTGTACGGGTATTGTGAGAGAC
ATTGGTATCCAGAGAATAAAGCAAGATGAAAACGATATGGAGATGGTTCGTCGGTATCTTAGCTCCAAGGAAGCT
GGGCCGTGGCTCTTCATTGTGGACAATGCAGACGATTACGACATATTATTTGGAAGCGACGGTGTGCGAGGTCGG
CTTTGCAAATACTTTCCAGCTAGTGACACCGGCGTTATCTTGCTTACCACCCGGTTCAGTCGGGTGGCGGAATGT
TTCACGTCACAGAGAGATACAATCCAACTCTTGCCAATGGAAGCAAATGAAGCGATTGCTTTGTTCGAGAAACTC
GTGGCAAATACTCTCATCCACAGTCGAAAGATGACAGAAAAGCTACTCGAAGAGCTCAGCTGGCTGCCTTTGGCT
ATCAAGCAGGCAGCTTCCTACATTGAATTCACCAATGTATCAGTTTCACGTTATCTCGATCTTATGCATGGTACA
GACGAAGACAAAGAAACCCCCGCGAGTTGTCATTTTCATGATGATACTCGCTACCCGCAGCTGCAGAATTCTATT
GCTCAAATATGGCGTATCTCATTCGAAAAGATCAAAAGGTCAGATCCTATCGCCGCTGATATACTGCAGTTCATG
TCTTGCATTGCGCCGAAAGCCATTCCACGGTCTCTCCTGCCTTTGTACAAATCGGAAGCGCAAACTGAATCCGCA
ATCAATACGCTATGTGAATATGCATTGGTGACCAGAGGGACAGATGGAGTCACGCTTGAAATTCACGATATAGTT
CAGCTCGCAACGCTATGGTGGATTGACCAAAAAGGCGAAGCGTTAGAGACAACCAGGAAGGTCACGCAGCGTATG
GTCAAGACATTCTCACCGCGGGGCCAGACCAATGAACATACGAGGAGGGCGTACGTACCTCATGCTCTTGAACTT
CTTCGTAAGACAGAGGGTCGAGATATACACGAACGGTATGAGCTCATCTTAAAAGTTGTGTCCTGCCTCATAGAT
GATGGTAGGGTGGAAACGGCCATGGAATTACTGAAGGAAAAGGCCAAATGGGACCAAACCCGCCATTGTGAAGAA
CATCCCTCTGGGCTGAGACCTCAAACATTTCTCACTGGGGCATATGCAGCAGATGGGCAGACAGAAAAGGCCATG
AAGCTGAGCGAGTATATCGCCCCGGCGAAAGAGAGAGGAATGCAAGAAGCTCACTCTGAGCAAGTGCTTCCAGAA
TGGTTTGGAGCGCAGACGAGCAAGCTCAGAAAGCAGCAGAGCTCTTCGGATATTTTGGCGAGACGGAATTATCTG
AGACAGCAGAGAAATCAGTCAGCAAAGCGCGCCCTAACCTACGAGAGTGTCAGCCTCAACTCGAAATACCTTGTG
GACAGCTCGGGAGATTACGCGGGCGAGAGAGTCACTCAGGCATGTGGTTATGATCGGGCAGAGACATTCCGCCCA
AGAGGGATTCATCTCTACTAG
Gene >Pro_DTO377G3_2|g7918.t1
ATGGAAAGGATCCGCGATGTTCATCATCTTGATTATACCCCACGCCCGTGTGACCATTTCGACTTGATCGGGGGT
ACAAGCACTGGAGGGTATGTCTGTGTGTGGTACATACAGGGTTAATGTACTAATATACTATAAGGATCATCGCTA
TTATGCTGGGTCGGCTGGGAATGACCGTGGATGAATGCATTCGAGCATACCGAAAGGTCGCGGAGCGTGCTTTTA
CTCGCAAGGCACATGCCATTATTCCAGCACGGCCCAGGGGAGCTTTCTCTGCGCGCGCACTGCAGGAGGCTATCA
AACAGGTAGTTCGGGAGTTCTGCACAGAAAAAGAATGCGTGGAACGTCGGCGCAATGGTCTCTCTATAACTGACT
GTCAACACTCTGATCTACCGTTTCGTGAGCAGACATGCACCAAAACGTATGTAGCTATTTAATGCAGAGATTAGA
TTAGTATTGACAAATAACAGGGTTGTTCTTGCGGTTACGAAAGTGAATATTGACGCGGGACCTACGCTCTTTCGC
ACATACGACAAATCCACTGCGCTTGATGGCTGCGCTATTTGGGAAGTTGCCCGCGCTACCTCAGCTGCATCCACG
CTCTTCAAGTCAATTAGACTTGGTCGAGACAACATCGAGTACATTGATGCAGGATTCGGCTATAACAACCCATGC
GAACAGCTTATTGCAGAAGCTAAGAAGGTGTTCCCTGGACGTAGCGATATGCAGACTCTGAGTATCGGAACCGGC
ATTGGAGATGTGGTCGGCATAAAAAATGGGCGCCTGTCAATCATTGGTGCACTGAAGAGGATGACTACGTCCCCC
AACAGGGTAAACACCAACATGGAAGACTACCATGGCGACAGCGGCCAGTATTTTCGATTCAATGTGCAACATGGC
CTTGGAGATATCTCTTTGTCAGACTGGAAGCAGGCTAGCAGGATATCTGCATACACAAGCATTTATCTCTCCGAG
AAGTCCAAGGATATCGAGAAATATGTGAAGACGTATGGGGCAAGGAGTCAACAAAATGAGCTGAATGAACCTCAG
TTTACGAAGATTCTAATAGTCGACCCTGTTCAAAAAGTTGACGTGGTTCTAGGCAAGCTAAAGGCCTACCATATG
ATCCCCTTTGTTGCAAATGAAGACTTCACTGGACGTGAGATTGTACTAAGCAGGCTGCAAGAAAGGCTCTTTCTT
CAAAAGACCGCCCGTAAAGTGGCCTTGTACGGAATCGGAGGCATTGGCAAAACCCAGGTTGCCTTGCACTTTGCC
TATTGGGTAAAGAACAACATGCCACAGTATTCAATATTTTGGATCCCGGCATTCAGCGAAGCCAGCTTTGAGCAA
GCGTGTACGGGTATTGTGAGAGACATTGGTATCCAGAGAATAAAGCAAGATGAAAACGATATGGAGATGGTTCGT
CGGTATCTTAGCTCCAAGGAAGCTGGGCCGTGGCTCTTCATTGTGGACAATGCAGACGATTACGACATATTATTT
GGAAGCGACGGTGTGCGAGGTCGGCTTTGCAAATACTTTCCAGCTAGTGACACCGGCGTTATCTTGCTTACCACC
CGGTTCAGTCGGGTGGCGGAATGTTTCACGTCACAGAGAGATACAATCCAACTCTTGCCAATGGAAGCAAATGAA
GCGATTGCTTTGTTCGAGAAACTCGTGGCAAATACTCTCATCCACAGTCGAAAGATGACAGAAAAGCTACTCGAA
GAGCTCAGCTGGCTGCCTTTGGCTATCAAGCAGGCAGCTTCCTACATTGAATTCACCAATGTATCAGTTTCACGT
TATCTCGATCTTATGCATGGTACAGACGAAGACAAAGAAACCCCCGCGAGTTGTCATTTTCATGATGATACTCGC
TACCCGCAGCTGCAGAATTCTATTGCTCAAATATGGCGTATCTCATTCGAAAAGATCAAAAGGTCAGATCCTATC
GCCGCTGATATACTGCAGTTCATGTCTTGCATTGCGCCGAAAGCCATTCCACGGTCTCTCCTGCCTTTGTACAAA
TCGGAAGCGCAAACTGAATCCGCAATCAATACGCTATGTGAATATGCATTGGTGACCAGAGGGACAGATGGAGTC
ACGCTTGAAATTCACGATATAGTTCAGCTCGCAACGCTATGGTGGATTGACCAAAAAGGCGAAGCGTTAGAGACA
ACCAGGAAGGTCACGCAGCGTATGGTCAAGACATTCTCACCGCGGGGCCAGACCAATGAACATACGAGGAGGGCG
TACGTACCTCATGCTCTTGAACTTCTTCGTAAGACAGAGGGTCGAGATATACACGAACGGTATGAGCTCATCTTA
AAAGTTGTGTCCTGCCTCATAGATGATGGTAGGGTGGAAACGGCCATGGAATTACTGAAGGAAAAGGCCAAATGG
GACCAAACCCGCCATTGTGAAGAACATCCCTCTGGGCTGAGACCTCAAACATTTCTCACTGGGGCATATGCAGCA
GATGGGCAGACAGAAAAGGCCATGAAGCTGAGCGAGTATATCGCCCCGGCGAAAGAGAGAGGAATGCAAGAAGCT
CACTCTGAGCAAGTGCTTCCAGAATGGTTTGGAGCGCAGACGAGCAAGCTCAGAAAGCAGCAGAGCTCTTCGGAT
ATTTTGGCGAGACGGAATTATCTGAGACAGCAGAGAAATCAGTCAGCAAAGCGCGCCCTAACCTACGAGAGTGTC
AGCCTCAACTCGAAATACCTTGTGGACAGCTCGGGAGATTACGCGGGCGAGAGAGTCACTCAGGCATGTGGTTAT
GATCGGGCAGAGACATTCCGCCCAAGAGGGATTCATCTCTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail